KEGG   Runella slithyformis: Runsl_5229
Entry
Runsl_5229        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: SmpA_OmlA
Other DBs
NCBI-ProteinID: AEI51528
Position
complement(6075169..6075573)
AA seq 134 aa
MKEIKHIYTGLIALIIPLMLLSACSSAPEKIGNLDLVKWRSDRGGCKGVRKGLESEFVKI
QGELLGKHIDEVGFMLGRPDIHQLGARDQNFYVYFLDKGVHCTDITQKSAAQKAILRFNA
VGLLSEITFQARPL
NT seq 405 nt   +upstreamnt  +downstreamnt
atgaaagaaataaaacacatttatacgggcttaattgctcttattataccattaatgctg
ctttcagcctgctcttcggctcctgagaagatcggaaatctggatttagtaaaatggaga
agtgaccgaggggggtgtaaaggcgtcagaaaagggcttgaaagtgagtttgtgaagatt
cagggtgaacttttgggaaagcatatcgatgaagtggggtttatgttggggcgtccggat
atacatcagctcggcgcacgtgaccaaaacttctacgtctattttctggataaaggagtg
cattgcacggatataacccaaaaatcagccgctcagaaggccatcttacgatttaatgcc
gtcggactgctttcagaaattacttttcaggcacgacctttgtag

DBGET integrated database retrieval system