KEGG   Runella slithyformis: Runsl_5230
Entry
Runsl_5230        CDS       T01553                                 

Definition
(GenBank) peptidase M28
  KO
K00683  glutaminyl-peptide cyclotransferase [EC:2.3.2.5]
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rsi01002]
    Runsl_5230
Enzymes [BR:rsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.5  glutaminyl-peptide cyclotransferase
     Runsl_5230
Peptidases and inhibitors [BR:rsi01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   Runsl_5230
SSDB
Motif
Pfam: Peptidase_M28 DUF4910 Peptidase_M20
Other DBs
NCBI-ProteinID: AEI51529
Position
complement(6075603..6076604)
AA seq 333 aa
MEKIRKGLYLSALVLALVNCNSKPSSEQTTAGETATTMVKAPSFSGDSAYAYVEKQVKFG
PRVPNSAAHTRCGDYLVAELKRLGCTVTEQKFTAIHYDGRKLNARNIIGSINPQATKRIL
LASHWDSRPVADEDPINKAGPIDGANDGASGVGVLLELARTLQVSAQKPGVGVDLIFFDV
EDGGNAAVAKDKFTGFCLGSQYWAANKHLPGYSAYFGVLLDMVGAKGATFPKEAFSNQYA
NEVTRMIWNTASQLGYSAYFVEQDGAAITDDHLPVNEIAKIPMVDIIHLQLNNTQKTFFD
DWHTHEDDMRNIDANTLKAVGQVLLQVLYQESI
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggagaaaatccgaaaaggattgtacctgtcagcgttggttttggctttggttaactgc
aactccaaaccatcctctgaacaaaccactgccggtgaaaccgcaacaactatggtgaaa
gccccgtcttttagtggagattctgcttatgcctatgtggaaaagcaggtgaaatttggc
ccccgggtgcccaattcagccgctcatacccgctgtggtgactacctcgtggccgaactg
aagcgcctggggtgcaccgtgaccgaacagaaatttaccgcaatccactacgacgggcga
aaactcaacgcccggaatatcatcgggagtatcaatccgcaggccaccaaacgaatcctg
ttggcctcccattgggacagtcgccccgtagccgatgaagatccgatcaataaagcaggg
cccatcgacggtgccaatgacggtgccagcggcgtgggtgtattgctggagctggcccgt
acccttcaggtatcggctcaaaagcccggtgtaggtgtcgacctgatcttttttgacgtg
gaagacgggggcaatgccgccgtagctaaagataagtttacgggattttgtttggggtcg
caatattgggcagccaacaaacaccttccgggctactcggcctactttggtgttttgttg
gatatggtgggggccaaaggggcaacgtttcccaaagaagcgttttccaatcaatatgcc
aatgaagtcactcgtatgatatggaacacggcgagccaattgggctacagtgcttacttt
gtagagcaggatggagcggcgattaccgacgaccatttacctgtgaatgaaattgctaag
atacccatggtagatatcattcatcttcaactcaataatactcaaaaaacattctttgat
gactggcatacccatgaggacgacatgcgcaatattgatgccaataccctgaaagccgta
gggcaggtattgttacaggtgctgtatcaggaaagtatctaa

DBGET integrated database retrieval system