KEGG   Runella slithyformis: Runsl_5231
Entry
Runsl_5231        CDS       T01553                                 

Definition
(GenBank) acyltransferase 3
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Acyl_transf_3 Bmt2
Other DBs
NCBI-ProteinID: AEI51530
Position
complement(6076724..6077767)
AA seq 347 aa
MESNNFHFIRFLAASLVIVGHVYPLNDRRDVIEQWSLGLFPSGHIAVCIFFVISGYCVLH
SRIHSSSSFSYLMKRVLRVFPGLLIALIFTVFIVGSITTTLPLSEYFTNRNTYLFFDNLK
LYPFNHTTLPGVFEQNPHSGVNGSLWTLTYEFTMYIFVVVAVFLFRSKWQWFLLAFCAFF
ILYCFFFEPLQGNRILPIIHLNIFHLIDFGIYFALGMLFYVYRHLIVLNGRWALAAFGSW
MLMYLIADAGYLPLAAIMWVRYFSLSYMIMYVSMIKGPLNHFGDRGDYSYGIYIYAYPIQ
QMIITFWGNEMSPFQQILLAFIFILPLAWFSWHIVEKPALKFKLYFR
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaatctaataactttcattttatacgatttttggctgcatcactggtgattgtcggc
cacgtatatccccttaacgaccgccgggatgttattgaacagtggagtttgggcttattt
ccctccggtcatattgccgtatgtatattttttgtgatcagcggttattgtgtattacac
agcaggatacatagctcttcttctttttcataccttatgaaacgcgtacttcgggttttt
cccgggctattgattgcacttatctttacggtttttatagtaggaagtattacaacgact
cttccgctttctgaatacttcactaacagaaatacctatcttttttttgataaccttaaa
ctgtatccttttaaccatacaacgcttcccggggtctttgaacaaaacccacattcagga
gtcaacggctcactgtggacgctgacctatgagtttacaatgtatatttttgtggttgtc
gctgtttttttgtttcggtcaaaatggcaatggtttctgttagctttctgcgcttttttt
attctttattgttttttctttgaaccccttcagggtaatcggattttaccaatcatccat
ttgaatatcttccatctgattgattttgggatttattttgcgttagggatgcttttctat
gtttatagacatctgatcgtgttgaatggccggtgggcgttggctgctttcgggtcttgg
atgctgatgtatctgatcgcagatgccgggtatcttccgttagcggctattatgtgggtt
cgttatttcagtctttcctatatgattatgtacgtgtccatgataaaaggaccgctgaat
cactttggcgacagaggagattactcctacggtatttacatctatgcctatcctattcaa
cagatgatcattacgttttggggaaacgaaatgtcgccctttcaacagattttacttgcg
tttatctttattttacccctggcctggttctcatggcacattgttgaaaaacctgcctta
aaatttaagttgtatttcaggtaa

DBGET integrated database retrieval system