KEGG   Runella slithyformis: Runsl_5232
Entry
Runsl_5232        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Lipase_GDSL_2 Nuc_deoxyri_tr3
Other DBs
NCBI-ProteinID: AEI51531
Position
complement(6078170..6079189)
AA seq 339 aa
MVHFVKIGSVCCLLLLYFNTAAQTVDCNNTKCIPVTVKIVGKDFALPPPTTLPAPLINLQ
SGQYPFGTVISFDIPVGLNIQSANTLSQLTFEYMWDFDNSWKTGTEAALKRSGTLSVRTR
LGTSTSEIQKHTYQLFYKQVLLIGNSFTQHLPYEPIGWTGNWGMAASAPDKDYKSTLERY
LQATYSDTKVKIFPTGRIENDFNNYDFENQLRYSKTTFQESDLIVLRFGENVKDWEIPMQ
DGKANKAYKETIIKFINMVRQNSSARVVITSVFWQGFPNTNAVLKEVADENGYDWVNLIE
IGKDNSNYAYGLFTDPGVAMHPNDKGMKAIADLIYEKIK
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggttcactttgttaaaattggttcggtatgttgtcttttacttttgtactttaacaca
gctgctcaaacagtagattgcaacaatacaaaatgcatacccgttacggtaaaaatagtt
gggaaagattttgcattacctcctccgactactcttcctgctccgcttatcaatttgcaa
agcggacagtatcctttcggaaccgtcatctcatttgatatacctgttggattaaacatt
caaagtgccaatacattgtcgcagcttacttttgagtatatgtgggatttcgataatagt
tggaaaacaggaaccgaagccgcccttaaaagatcaggaaccctttccgttcgaacaagg
cttgggacgtctacttcagagattcagaagcatacttaccaactattttacaaacaggtg
ctgcttataggcaatagctttacgcaacatctgccctatgaaccgatcggttggaccggg
aattgggggatggctgcctcagcacccgataaagattataaatcaaccctggaaagatat
cttcaggctacctacagcgataccaaagtgaagatatttccgaccggccggattgaaaac
gatttcaataattatgattttgagaaccaactaagatactcgaaaactacttttcaggaa
agcgatctgattgttttgcgctttggtgaaaacgtgaaagattgggaaataccaatgcag
gacggaaaagcaaacaaagcctataaggaaaccattatcaaatttatcaatatggttagg
caaaattcttctgccagggtggttattacaagtgttttttggcagggtttccccaatacc
aatgccgtccttaaagaagtggcggatgaaaatggatatgattgggtaaatttgatcgaa
attgggaaagataacagtaattatgcttacggattatttacggatcccggtgttgcgatg
caccccaacgacaagggtatgaaggctatcgcggatttaatttatgaaaaaattaaataa

DBGET integrated database retrieval system