KEGG   Runella slithyformis: Runsl_5234
Entry
Runsl_5234        CDS       T01553                                 

Definition
(GenBank) Glycoside hydrolase family 42 domain protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: He_PIG Glyco_hydro_42 Glyco_hydro_14 Por_Secre_tail
Other DBs
NCBI-ProteinID: AEI51533
Position
complement(6082452..6085007)
AA seq 851 aa
MRQLQRICLWVFGCVLLLLSHLTSANDGQRYLAVLLLNTNRSLDIDLDLLEGGVKAGCNA
VHLTIYWDQVYTTSTSQADWRKYDNQINLAQKLGVKIALRILVGRHVSRIQGFWENEHRQ
RDQQGQALISGYSATYFSYAHRPSVEKARAFIKEVCQRYNNLQQQGIISWVSVSTTPTQE
TAYYHENAPEGWNYPTVFDYSPSMQQEFRIWLTRKYKKIARLNVFWETEYRSFEEVTPPV
SFKYREQVFWGAAGRDWYVFRHAVFKQFVEQTTQTIKEVNSSYRVMTDFGSVFDQISVFC
GTLAFRDLNRTTDGVKINDDLLYDHRFSTDLLRSNVLPGQWVLNEVFPILKQGQSPDLIP
KQIDENFEHGAHWVSMVIDTRATLDLVRPIIRQTEEKWLKKPFSAVNPVDQMSYTLSRVV
EFGYYSGGVYSEWLNRAGHVSNRKPVNIRMVEDLLTDTLQGSINQPPAVQNMMPTKYIKV
HTDFTYRLKSEVFADIDGAIEKVEVSGLPPWLTFQNNVFSGTPAQTGIYRMLLRATDDDG
ASVETAFTIIVDNTGRANQVPVLQQAIPAAKGVYKQPFTYTISDQTFSDPDGFISRLEVT
GLPRWAQFGRKEIRGLADTVGVYIVTVRAFDDEDAVVQTTFTITVSYPVVSFDLVQAGKP
GERFLIKRLQNGEALEASGLPPLLNIYASCDAVFDEFELQLTGTYAQKAQPESSPFALFK
GDGGFPTVVGSYQLKGNAYFQKELISSITYRFQLIATDPVTKLPISLTDWTLYPNPCNEF
LNIKLPDKVAVQKIQLVNTEGQTLPVLLNAASVTNQLLSINLRELALPPGLYFLKLQKGD
FFWEVFKFLKQ
NT seq 2556 nt   +upstreamnt  +downstreamnt
atgaggcagttgcagcgtatatgtttgtgggtttttgggtgtgttttactgttgctttcc
caccttacttcggccaatgacgggcagcggtatttggctgttttgctgttgaataccaat
cgctcgctggatattgaccttgatttgctggagggaggggtcaaagcgggctgtaatgcc
gtacatttgaccatttattgggatcaggtctatactacttccacttctcaggccgattgg
cgcaaatatgacaatcagatcaaccttgcccaaaaattaggcgtaaaaatagcccttcgc
attttagtaggtcgacatgtaagtcgaattcagggcttttgggagaacgaacaccgacag
cgcgatcagcaggggcaggcgttgatctcgggctacagtgccacgtatttcagttatgct
caccgcccttcggttgaaaaagcccgggcatttatcaaagaagtgtgtcaacggtataat
aacttacagcaacagggcattatctcgtgggtatcggtttccacaacccctacgcaggag
acggcctattatcatgaaaacgcccccgagggttggaattatcccacggtgtttgattat
tcgccgtccatgcagcaggaatttcgcatttggttaacccgtaaatacaaaaaaattgcc
cggctgaatgttttttgggaaacggaataccgcagttttgaagaagtaactccgcctgtg
tcgtttaagtaccgtgaacaggtattttggggggcggcaggtcgtgactggtatgttttt
cgtcatgcggtattcaaacaatttgtggaacagaccacgcagaccatcaaagaagtaaac
agtagttaccgcgtaatgaccgatttcggttccgtttttgaccagatcagcgttttctgc
ggcacgctggccttcagagatctaaatcgtaccacagacggcgtcaagatcaatgacgac
ctgctctacgaccaccgattctccactgatcttttaaggagtaatgttcttcccgggcag
tgggtattaaatgaagtttttcccatattgaaacagggacaaagtcctgaccttattccc
aaacaaattgatgaaaattttgagcacggagcgcattgggtcagtatggtcattgatacc
cgggcaacccttgacctggtgcgcccgatcattcgccaaacggaggagaagtggctgaaa
aagcctttttcggcagtcaaccccgtcgatcagatgagttatacactttcccgcgtggtt
gagttcgggtattacagcggcggcgtgtatagcgaatggctcaatcgagcggggcatgta
tcaaatcgaaaacccgtcaatattcggatggtagaagacttgttgaccgatacacttcag
gggtcaattaatcagcctccggcagtacaaaatatgatgccgaccaagtatattaaagta
cataccgattttacctaccggctgaaatcagaagtatttgccgatattgatggcgccatt
gaaaaagtggaggtcagcggattgcctccatggttaacctttcaaaataacgtattttcc
ggtactcctgcgcaaacgggcatttatagaatgcttctcagagcaaccgatgatgacggg
gcaagtgtcgaaaccgcctttaccattattgtagacaataccgggcgagccaatcaggta
cctgtgttgcagcaagccatccccgctgctaaaggagtttacaaacagccatttacttat
acgatatccgaccaaactttttccgacccggatggcttcatcagtcggttggaagttacg
ggactgccccgatgggcacagtttgggagaaaagaaataaggggactggccgataccgta
ggcgtttatatcgttacggtacgtgccttcgatgatgaagatgccgtagtacaaaccacc
tttaccattacggtcagttatccggtggtatcatttgacttagttcaggcgggtaaaccg
ggggaacgatttctgattaaacgcctgcaaaacggtgaagcacttgaagcatccggccta
ccgccgctgctcaatatttacgcgtcctgtgatgctgttttcgatgaatttgaacttcag
cttacggggacctacgcccaaaaggcgcagcctgaaagttctcctttcgccctttttaag
ggagatggcggttttccaacggtcgttggctcatatcagttaaaaggaaatgcgtatttt
caaaaggaattaatttcttccatcacctaccgttttcaactgattgcaactgaccccgtt
acgaaactgccgatatcattgacggattggactttataccccaatccctgcaatgagttt
ctgaacatcaagcttcctgacaaagttgctgttcaaaagatacagttggtgaataccgag
gggcaaacgctgccggtgctgctcaatgccgcttccgttacaaaccaactgctatccata
aacttaagggagttggcgcttcccccgggactttattttttgaaattacaaaaaggtgat
ttcttctgggaagtatttaaatttttaaagcaataa

DBGET integrated database retrieval system