KEGG   Runella slithyformis: Runsl_5235
Entry
Runsl_5235        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: LPAM_1
Other DBs
NCBI-ProteinID: AEI51534
Position
complement(6085117..6085629)
AA seq 170 aa
MKKYIYAALFISTALLAGCSKSEPEPEPAEQVIGSYTVDKITDAYKYASSPTEYAETTVY
PLKGTTSTGIGYEVNAVLDVAKTASNIVNITFTQTAKLSNGQTQKDNFAYTGIELKKIEG
ASGQFEMLETGVKIGTITKTAINIEEVTSAKDSTGASYTYTLRISGKKTI
NT seq 513 nt   +upstreamnt  +downstreamnt
atgaaaaaatacatttacgctgccttatttatatcgaccgccttattggccggctgttca
aaatcggaacctgagccggaacccgctgagcaggttattggaagctatacagtggataaa
attactgatgcgtataaatatgcctcttcacccaccgagtatgccgaaacaaccgtttat
cccctcaaaggaaccacgagtacggggataggctatgaagtgaatgcggtcctggacgtt
gctaaaacggcttcaaacattgtaaacattacgtttacgcaaaccgcgaaattgtctaac
ggtcagacccaaaaagataattttgcctataccgggattgaattaaagaaaattgaaggc
gcttccggacaatttgagatgcttgagacgggcgttaagatcggcaccattaccaaaacc
gcgatcaatattgaagaggtaacaagtgccaaagactctaccggagcttcttacacctat
acccttcgtatatcgggtaagaaaacgatctaa

DBGET integrated database retrieval system