KEGG   Runella slithyformis: Runsl_5236
Entry
Runsl_5236        CDS       T01553                                 

Definition
(GenBank) ThiJ/PfpI domain-containing protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DJ-1_PfpI GATase_3
Other DBs
NCBI-ProteinID: AEI51535
Position
complement(6085820..6086431)
AA seq 203 aa
MTRNVAIFLFDEVEVLDFAGPYEVFSVTGLRTLAEKPFHVYTVAEKSPIRARNGLTVLPD
YLLDNCPKPDIILIPGGGGFSAEGVPFGSRREMYNSVVLEWVRKHASRVELVLSVCTGAL
ILGNAGLLEGLKATTHFKALDGLRAISPGIDVVEGVRYVDNGRVILSAGVSAGIDMSYYV
VSKLLGKDTADEAARYAQYDYWR
NT seq 612 nt   +upstreamnt  +downstreamnt
atgacccgcaacgtagctattttcttatttgatgaggtggaagtgcttgattttgccgga
ccgtatgaagtgttcagcgtcacgggattacggaccttggccgaaaaaccctttcatgtc
tataccgtggccgaaaaatccccgatcagggcccgaaacggattgactgttttgccggat
tatttattggacaactgtcccaagcccgacattatactgataccgggcggtggcggtttt
tcggcggagggtgtgccgtttggcagtcgacgggagatgtacaattctgtggtgttggaa
tgggtaagaaaacacgcttcccgcgttgagttagtcctttcagtgtgtacgggagcattg
attttgggaaatgccggacttttggaagggctgaaagctacgactcactttaaagcattg
gatggattgcgggccatttcccccggcattgatgtagtggaaggagtgcggtacgtagac
aatgggcgggtgattctttcggccggggtatcggcggggatagacatgtcttattacgtg
gttagcaaacttttgggaaaagacaccgctgatgaggctgcacgttatgcgcaatacgat
tattggcggtaa

DBGET integrated database retrieval system