KEGG   Runella slithyformis: Runsl_5237
Entry
Runsl_5237        CDS       T01553                                 

Definition
(GenBank) protein of unknown function DUF6 transmembrane
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: EamA TPT RseC_MucC
Other DBs
NCBI-ProteinID: AEI51536
Position
complement(6086580..6087497)
AA seq 305 aa
MQQSSSVKLWVNLVIVYVVWGSTFLGVRYAIEVLPPLLTNAIRFLLGGIVFFLFTLLRGY
SVPSLRQWLSAAWIGMLLSGVGNCAVAYAIGFMPTGLVALLVATLPGWMVGLDYYFFGKQ
KPSWLTVVGLGVGLVGMYILLNPADSLAQREIPLFPAFLVFVGSITWAWGSLQSPYLDMP
PQMQTTAIQMLGGGVFSLLMSLFLEPGGFTKMADMTTQTYLALAYLIVMGSFIGYSAYVW
LLHHAPPSLTATYAYVNPVVAMILGRIIVSEKLSTRSLIASGVVLTGVILITFGRRASNR
AAKVS
NT seq 918 nt   +upstreamnt  +downstreamnt
atgcaacaatcatcttccgttaagctttgggtcaacctggtcatcgtgtatgtagtttgg
ggttctacctttttgggagtgcgctatgccattgaagtattgcctccgttgttgaccaat
gccattcgttttttgctgggaggaattgttttctttttgtttacgctgctgcgagggtac
tccgtgccgagcctgcgtcaatggctttctgccgcatggatagggatgctgttgagcggc
gtgggcaattgtgccgtggcctatgccatcgggtttatgcctacagggcttgtggcgttg
ttggtagccaccctccccggctggatggtagggttggattactattttttcggaaaacaa
aaaccttcgtggcttacggtagttggtttaggcgtgggcttggttggaatgtatattttg
ttgaatcctgccgatagtttggcgcaacgggaaatcccgttgtttccggcctttttggtc
tttgtcgggtccatcacgtgggcatggggctcactgcaatcgccttacttagacatgccg
ccccaaatgcagaccaccgccattcagatgttgggcggcggcgtgttttcgttgctgatg
agcctgtttctggagccgggaggttttacaaaaatggccgatatgaccactcagacctat
ctggcccttgcgtatttgatcgtgatggggtcgtttatcggctactcggcctatgtgtgg
ttgctgcaccatgcacccccttcgctgacggctacgtatgcctacgtcaatccggtcgta
gcgatgattttaggccggatcattgtcagcgaaaaactcagtacccgttcattgattgct
tcgggagtggtattgaccggcgttattttgattacgtttggcagaagagcctcaaacaga
gcggcaaaggtcagttaa

DBGET integrated database retrieval system