KEGG   Runella slithyformis: Runsl_5238
Entry
Runsl_5238        CDS       T01553                                 

Definition
(GenBank) Multi-copper polyphenol oxidoreductase, laccase
  KO
K05810  polyphenol oxidase [EC:1.10.3.-]
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Runsl_5238
Enzymes [BR:rsi01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.-  
     Runsl_5238
SSDB
Motif
Pfam: Cu-oxidase_4
Other DBs
NCBI-ProteinID: AEI51537
Position
complement(6087572..6088321)
AA seq 249 aa
MQLFHSPAIFQRFSNLIAAESKRQGGVSFAPFASLNLGINTADAPENVQENRRRFFEKLG
VPEHSLASSLQVHGEAIRIVTQPERTEGFDAFITEVPGVVLGVTVADCTPVLLYDARRRV
VGAVHAGWRGTVLQLVYKTLDAMHWEYGTEPGDCYAYVGTCIDECAFEVGEEVADRFSEK
YKRYDAVVGKFMVDLKRANEDQLKAFGIPSAHIEISPFSTVTHNADYFSYRLEKGQTGRM
LAVIGLKNE
NT seq 750 nt   +upstreamnt  +downstreamnt
atgcagttatttcattctcccgctatttttcaacgcttttctaacctcattgctgctgaa
agcaagcgacagggcggtgtgagctttgctccctttgcgtccctcaatttgggaatcaat
accgctgatgcccccgaaaacgtacaggagaaccgccggcggttctttgaaaaattgggc
gtgcctgaacacagcctggcgtcttcgctgcaggtacacggtgaggcaatccggatcgtg
acccaacccgaacgtaccgaagggtttgatgcctttatcacggaggttccgggggtagta
ctcggggtgaccgttgctgactgtacaccggtgctcctatatgatgcccgccgcagggta
gtgggtgcggtccatgccggatggcgcggcaccgttttgcaactggtctataaaaccctc
gacgccatgcactgggaatacggcaccgagcccggcgattgctacgcctacgtgggcacc
tgcattgatgaatgcgcttttgaagtgggagaggaagtagcggaccggttttcggaaaag
tacaagcggtatgatgccgtggtcggaaagtttatggtcgaccttaaacgcgccaatgaa
gatcagttgaaggcatttgggattccttcggcgcatattgaaatctctccgttttccacc
gtaacgcacaatgccgattatttctcgtaccgcctcgaaaagggacagacgggacggatg
ctggccgtgatcgggttaaaaaatgagtga

DBGET integrated database retrieval system