KEGG   Runella slithyformis: Runsl_5239
Entry
Runsl_5239        CDS       T01553                                 

Definition
(GenBank) Orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
rsi  Runella slithyformis
Pathway
rsi00240  Pyrimidine metabolism
rsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Runsl_5239
Enzymes [BR:rsi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     Runsl_5239
SSDB
Motif
Pfam: Pribosyltran UPRTase
Other DBs
NCBI-ProteinID: AEI51538
Position
complement(6088334..6088990)
AA seq 218 aa
MQTTVAANRPDVARQIAAHLLNIEAIQLRPEQPFKWSSGWNSPIYCDNRLALSFPEVRTY
IKNSLAGAIKSHFPAAELIAGVATAGIAQGALVADVLHMPYAYVRPEPKKHGMGNQIEGR
VLKGQKVVVLEDLISTGGSSLKVVDVLREAGAEVLGMISIFTYGFSIADENFKQKDVPLV
TLSDYDCMLTEALKLDYIESGQLDTLTKWREDPGSWGV
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcaaactaccgttgccgcgaatcgtccggatgtagcccgtcaaatagctgcgcatctg
ttaaacattgaagcgattcaacttcgtcccgagcagccttttaagtggagctccggctgg
aactctcccatctattgtgacaaccgtctggcgctttcgttccctgaagtgcggacttat
ataaaaaattcgctggcaggtgccatcaaaagccattttccggcggctgaactgatcgcg
ggagtggctacggcgggcattgcgcagggggctctcgtagccgatgtgttgcacatgccg
tatgcctacgtgcgccctgagcccaaaaaacacggtatgggcaatcagatcgaaggaagg
gtgctcaaaggccagaaagtagtcgtactcgaagaccttatctctaccggcggaagctcg
ctcaaagtggtggatgtgctgcgcgaagcaggcgcagaggtgttgggaatgatttcgatc
ttcacgtacggtttttccattgccgacgaaaactttaaacaaaaagacgtgccgttggtc
acgttgagcgattacgattgcatgcttaccgaagcgttaaagttagactatatcgagtca
ggccaattggatacccttacaaaatggcgtgaagatccgggcagttggggtgtgtaa

DBGET integrated database retrieval system