KEGG   Runella slithyformis: Runsl_5240
Entry
Runsl_5240        CDS       T01553                                 

Definition
(GenBank) UspA domain-containing protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Usp
Other DBs
NCBI-ProteinID: AEI51539
Position
complement(6089091..6089903)
AA seq 270 aa
MKTILVPIDLSDVSEYALEVAVGIAKKHGSTVILLKRLIFPTVEYTMIDNDFYEDKEDYY
RYLTQESKDRLKDMIDRPAYEGVKFKLTIVRQEESLADCVAHQKADLIVMGSTGASGWKE
WTKGSNAEHVVRKAPCPVLVIKSPVSAFTKVVFAVDFENEEFVKTSSALLDKTAIKPHFV
YVDNGTKIFDADALSEKVGKWAFELGYSVYHFEIVEESPIEKGILNYARKVEADIIMMYT
HGRKGLQHFIYGSIAEDVVNHAEMAVLVSH
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaaaactattcttgttcccatcgatttaagtgacgtttcggagtatgcccttgaggta
gcggtaggtattgccaaaaagcacggctcgaccgtcatcctgctcaaacgccttattttt
cctacggtagagtacacgatgatcgacaatgatttttatgaagataaagaagattactac
cgctatttgacgcaggaatccaaagaccgccttaaagatatgatcgacaggcccgcgtat
gagggggttaaatttaaactgacaatagtacggcaggaagagtcactggctgattgtgtg
gctcatcaaaaagccgatttgatcgtaatgggctcaacgggcgcgagcggctggaaagaa
tggacgaaaggctcaaatgccgagcatgtagtacgaaaagcaccctgcccggtactggtc
ataaaatcgccggtaagtgcgtttacaaaagtggtctttgccgttgattttgaaaatgag
gagtttgtaaaaacatcatcggctttattggataaaacagccatcaagccccactttgta
tacgttgacaacggaaccaagatatttgatgccgatgcattgagcgagaaagtcgggaaa
tgggcctttgaactggggtattctgtgtatcattttgaaatcgtggaagagagtcctatc
gaaaaaggcattttgaactacgcccgaaaagtagaagctgacattattatgatgtacacc
cacggccgtaagggactccaacattttatctacggaagcattgcggaggatgtggtcaac
catgccgaaatggccgttttggtcagtcattag

DBGET integrated database retrieval system