KEGG   Runella slithyformis: Runsl_5241
Entry
Runsl_5241        CDS       T01553                                 

Definition
(GenBank) response regulator receiver protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: PglZ Response_reg Phosphodiest
Other DBs
NCBI-ProteinID: AEI51540
Position
6090114..6091676
AA seq 520 aa
MANILWADDEIDLLKPHILFLTAKGYTITPVNSGSDALDKVESERFDVVFLDENMPGLSG
LETLAQIKQLRPNLPVVMITKSEEERIMEEAIGSRIADYLIKPLNPNQILLSVKKILDNK
RLVSEKTNISYMQEFRQLAMQYQDRIGHAEWVELYKKLIYWELELENTQDKSMEEILSNQ
KEEANNNFCKFVLDNYEDWLNDPNADKPILSHQLLKRKVFPLMKQTEPLFFILIDNLRYD
QWKVVEPLLSEFFTVEEESSYYSILPTTTGFARNSIFAGIMPSEIEKQYPNWWVNDENTP
EGEEGLNKHEEDLLRKQFERNRMQVRFSYTKIINQNQGKTLIDNLPNLWKNHLNVVVFNF
VDMLSHARTDMMMIKELAPDEAAYRSITRSWFQHSPIMDFLQRIAEKKGRIIITTDHGMT
RVKKPVKIVGYRETNTNLRYKQGKNLGFDDNNHIYVCRRPERLFLPKLNVSTAYVFTLGD
YFFAYPNNFNQYVNMYRDTFQHGGVSIEEMIVPFVFLKPK
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcaaatattctttgggcagatgatgaaatagatctattaaaaccgcatattttattt
ttaacggccaaaggctacaccattactccggttaatagtgggtctgacgcgctcgataaa
gttgaaagcgaacgatttgacgttgtgtttctggacgaaaacatgcccggcctttccggc
ttggaaaccctggcccagatcaagcaattacggcccaacctgccggtggtcatgatcacc
aaaagcgaagaagaacgtattatggaagaagccatcggctcccgcattgccgattacctc
atcaaaccgctcaaccccaatcaaattctgctttcggtcaaaaaaatcctggacaacaaa
cggttggtcagcgaaaagaccaacatcagctacatgcaggagtttcggcaattggccatg
caataccaggaccgcatcggtcatgccgaatgggtagaactttataaaaagctgatatac
tgggaattggaacttgaaaatacgcaggataaaagcatggaggagattctttccaaccag
aaagaagaggctaacaacaacttctgcaagtttgtactggataactacgaagattggctc
aacgaccccaatgccgacaagccgatcctgtcgcatcagttgctgaaacgtaaggtgttt
ccgctcatgaaacagacggagccgttgttttttatcctaatcgacaacctccgctatgac
caatggaaagtggtagagccattgctgagtgagttttttacggtcgaagaagaatcctct
tattattccattctgcccaccacgacgggttttgcccgtaattcgatctttgcgggaatc
atgccgagcgagatcgaaaaacaataccccaactggtgggtcaatgacgaaaatacgccc
gagggcgaagaaggactcaacaaacacgaagaagacctgctgcgcaagcagtttgagcgc
aatcggatgcaggtgcgattttcgtacaccaagatcatcaaccaaaaccagggaaaaacg
ctcatcgacaaccttcccaatctttggaaaaaccacctgaatgtcgtcgtctttaacttt
gtggatatgctctctcacgcccgcaccgacatgatgatgatcaaggaactggcccccgac
gaggccgcctaccggtccattacgcgctcgtggtttcagcactctcccatcatggatttc
ttacagcgcattgcggagaaaaaagggcgtatcatcatcaccaccgaccacggcatgacg
cgggtcaagaaacccgtcaagatcgtgggctaccgcgagaccaataccaatttacgctac
aagcagggaaaaaatctggggtttgacgacaacaaccacatttatgtatgtcgccggccg
gagcgcctttttctgcccaagctcaatgtatcgacggcctacgtgtttaccctcggcgat
tacttttttgcctatcccaacaacttcaatcagtacgtcaatatgtaccgcgataccttc
cagcacggaggggtatcgatcgaagaaatgatcgtgccgtttgtatttctgaagccaaaa
taa

DBGET integrated database retrieval system