KEGG   Runella slithyformis: Runsl_5242
Entry
Runsl_5242        CDS       T01553                                 

Definition
(GenBank) TonB-dependent receptor plug
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: CarbopepD_reg_2 CarboxypepD_reg Plug DUF2012 GGGtGRT SpaA Invasin_D3
Other DBs
NCBI-ProteinID: AEI51541
Position
complement(6091799..6094180)
AA seq 793 aa
MKYISTVFLKGTAPFCYVLMAVGLLLGHSLFSQTVLTQTLRGVVLDMDNNQPLTGASIAL
TGTEKGAVTEADGSFRITAVPIGRYTVQISSVGFETTVMPEILLEAGKEKVLTVLLKEAP
QQLQEAVVRSYRPVSQSSIQSISIEQTLRYAATFFDPARLATSFPGVVAANDQANNLVIR
GNSPTGMQWRLEGIEIVNPNHLSNAGTFSDRPTQSGGGTNILSAQLMERADFLTGAFPSQ
YGNALGGVMDVHLRKGNDQKHEFTAQAGLIGIDLAAEGPISRKNKSSYLINYRYSFTGLL
AAMGVKFGGEDIRFQDLSFNLSFPTRKAGHFTVFGMGGLSSNVFKAERDTLLWKVEKDGF
DIDYTNRMGALGVTHQLKLGANATLRTVLAASALDNRREGYVLSKTTYNRFPVQLDAFKK
TRYSFSATLSHKLNAQWQVQEGIYLTYQQDSVDISNRGIARGGMKGLIIQPYVNLMGRIA
PRLTLQLGLHWLEYTYNKTNSLEPRAALRYTAGKRTAFTVSYGLHSQLQLPQTYLALKNS
TTRDEVLPNVRLGFTKSHHFVAGFERTLSLLSSLKVEAYYQSLYNIPVAKNPSNKSSRVF
PAFSAINLLEGFTEGELSNTGTGRNYGIEVTYQQLLQNNFYALITGSLYNSTYKGQDGVE
RNTRFNGNHTFSLAGGKEFHRRANRAFGVNLRVLWLGGYRDSPIDLEASKSAAQTVYKAT
ELYTIKLKDYFRPDLRIFWKRNKANFTRTWSIDIQNLSSTKNEAYSYYDILQRKVVQQYQ
LGILPVVNYRVEF
NT seq 2382 nt   +upstreamnt  +downstreamnt
atgaaatatatatccactgtttttttaaagggcactgccccgttctgttatgtgcttatg
gcggttggactgctcttaggtcactcacttttcagtcaaaccgttttaacgcaaacccta
cggggtgttgtgctggatatggataataatcagccgcttacgggggcgagtattgccctg
acgggtacggaaaaaggcgcagtcacggaggcggacggcagcttccggatcacggctgtt
cccattggtcgctacacggttcagataagcagcgtaggctttgaaacgacggtgatgccc
gaaattttgttggaagcaggcaaagaaaaagtgttgaccgttttgctgaaagaagccccc
caacaattgcaggaagcggtggttcgttcttaccgacccgtttcgcaaagcagtattcaa
agtatcagtattgaacaaacgctgcgttatgccgctaccttctttgatccggcccgtctg
gcaacgtcgtttcccggcgtggtggcggccaatgaccaggccaacaatctggtcattcgc
ggtaattcacctacggggatgcagtggcgattggaaggcattgaaatcgtaaaccccaac
cacctcagcaatgccggaacattcagcgaccggcccacccaatctggtggcggaaccaac
attttgagtgcccaattgatggagcgcgctgattttctgacgggcgcgtttccttcccaa
tacggtaatgcactgggcggggtcatggatgtacatttgcgaaaaggcaatgaccaaaag
cacgagtttacggcgcaggcaggtttgatcggcattgatctggcggccgagggacccatt
tcccgcaaaaacaaatcctcgtatctcatcaattatcggtattctttcacggggttgctg
gctgcgatgggcgtgaagtttggcggagaagatattcgctttcaggacctttcgtttaac
ctttcgtttcctacgcgcaaagcggggcattttacggtgttcggaatgggcggtctcagc
agcaatgtttttaaggccgagcgtgatacacttctgtggaaagtggagaaagacggattt
gatattgactataccaaccgtatgggagcccttggggtgacccatcagttgaaattgggc
gcgaatgctaccctgcgaaccgtactggccgcctccgctttggacaaccgccgtgaaggt
tatgtactttcaaaaacgacctacaatcgctttcctgtccagttggacgcgttcaaaaaa
acgcgttattcgttttccgctacgctttctcataaactcaatgcccaatggcaggtgcag
gaagggatctatctgacctatcagcaggattcagttgacatcagtaatcgcggcatagca
aggggtgggatgaagggactgatcattcagccgtatgtcaatttaatgggaagaattgcc
ccgcgcctgaccctgcaattggggcttcattggttggaatatacctacaataaaacaaac
tcgttggagccgcgtgccgccttgcgctacacggcgggcaaacgtactgcgttcacggta
tcgtacgggctgcacagtcagttacaattgccgcagacgtacttagcgctcaaaaattca
accacccgcgacgaggtattacccaatgtacgtttaggatttacgaaatcacaccatttt
gtggcgggctttgagcggacgttatcgcttttgtcttcgctgaaagtggaggcctactat
caatcattgtataatatacccgttgctaaaaacccatccaataagagcagccgggtcttc
cctgcgttctcggcaattaatctgctggaaggtttcacggagggggagttgtccaacacg
ggcacgggtcgcaactacggaattgaggtgacgtatcagcaattgcttcaaaataatttt
tacgcgctcattacgggttcattgtacaattctacctacaaaggacaggacggtgtagag
cgcaatacgcgttttaacggcaatcatactttcagtctggcgggtgggaaagagtttcat
cgtcgggccaatcgtgcgtttggggtcaatctgcgcgtgttgtggctgggcggttaccgc
gattctccgattgatttggaggcttcgaaaagtgcagcgcaaaccgtgtacaaagctacc
gaactgtacaccatcaagctgaaggactatttccgtcctgacctgcgtatcttctggaaa
cggaataaagccaactttacccggacgtggtccattgatattcagaacctgtcaagtacc
aaaaatgaagcctacagttattacgatattcttcagcgcaaagtggttcagcaatatcaa
ttgggcattttgccggtcgtaaattatcgggtggagttttaa

DBGET integrated database retrieval system