KEGG   Runella slithyformis: Runsl_5243
Entry
Runsl_5243        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51542
Position
6094256..6094903
AA seq 215 aa
MSLKTTEAKLYYALYDFFEAEGFRLLMDKKQFRKNTPAGFTNIIFSVSEYEKEQDAWVEV
HIGCRNDQIEQIAQQFLNANSVDFRSDVNTLIISTGKYNDVNYFRYKIQNDEDLADACES
IRDFMQNAGFGFLASVTHVADIDRLLNLMPHKPSKYLYNQVHRCFKGIVAAKLNNSPRFD
QLIEIYRNYIVKFGNEVEVGNYERLIHFLRYYGKN
NT seq 648 nt   +upstreamnt  +downstreamnt
atgagcctcaaaacgacggaagctaaactgtattacgccctgtacgattttttcgaagcg
gaagggtttcgactgttgatggataaaaaacaatttcgcaaaaatacaccggccggtttc
acaaacattattttttcggtatcagaatacgaaaaagaacaggatgcctgggtagaagta
catattgggtgtcgtaatgaccaaattgaacagatcgctcaacaatttttgaacgccaac
tcagtcgattttcgctcggatgtcaataccctgatcatctccacgggcaaatacaatgac
gtcaattattttcgctacaaaatccaaaacgacgaagatctggccgacgcctgcgaatcc
atccgcgacttcatgcaaaatgcgggctttggcttcctggcttccgttacacacgtggcc
gatattgaccgtctgctgaatctgatgccccacaaaccttcaaaatacctgtacaatcag
gtacaccgctgttttaaaggaattgtggcggccaaattgaataacagtcctagatttgat
caactcatcgaaatttaccgcaactatatcgtgaaattcggcaacgaggttgaagtcggc
aattatgagcgacttatccattttttacgttattacggaaaaaactag

DBGET integrated database retrieval system