KEGG   Runella slithyformis: Runsl_5244
Entry
Runsl_5244        CDS       T01553                                 

Definition
(GenBank) Copper-exporting ATPase
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
rsi  Runella slithyformis
Brite
Enzymes [BR:rsi01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     Runsl_5244
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase ATPase-cat_bd HMA Hydrolase_3 S6PP TM2 YacG
Other DBs
NCBI-ProteinID: AEI51543
Position
6095020..6097494
AA seq 824 aa
MSQSIAPIVEVTCYHCGADCEDTVIVHDDKPFCCEGCKLVYELLQENELCSYYDFTKNPG
VSPDKNYYKGKYAYLDLPEVHQRIIQFTDGRQTHVNWYLPQMHCSSCVYLLENLHRLQEG
VFSAVVNFPEKRVRIIIDEEKIKLSQLAELLTYIGYEPYISLQDVESDQSPKTNRTRLYK
IGIAGFAFGNVMMMSFPDYFGLGDTLADRNLQVMFSIFSVVLALPVFFYAASDFFVSAWK
AIRKHYLNIDAPIALAILVTFVRSLYEIGTQTGVGYLDSMTGIVFFMLLGRYFQEKTYSV
ISFDRDYKSYFPVAVTKLGESKKEKEESADPNHHSPATDRQILVTDLQAGDRILIRNKEL
IPADARLVSERAMIDYSFVSGESEPVEKTRNELIYAGGRQVGGAIELEITKRVSQSYLTQ
LWNNDSFTQQNHKQQHDLVDRINRYFTWALLVLGLGGLSFWALSGDLPRGINAITTILIV
ACPCALLLSDTFTNGNILGMFGKHKFYLKNAKVIESLSEIDTVVFDKTGTLTLPDAGHIQ
FIGTPLTRLQQRIVRTMCEQSSHPLSRLIAKSLVMVPKETALTDFQEVEGKGIMSYLGNH
CTIKLGSAAFVGLKDVPTIASNSHSRVYFSFDGQQLGYYEIHSQYRENLSDTLQALKLKN
YQTFLLSGDKPTDTDVLGTLFGDTTHLHFNQKPEDKLAFIQQLQQKGRKVLMVGDGLNDA
GALVQSNVGIAVSDNVNNFSPACDGILEGSHLSFLPQYVRLAKAGRRIVVQSFIISVVYN
IIGLSFALTGTLAPVIAAILMPASSISIVLYTTLASRIATARTL
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgtcgcaatccatcgcacctatcgttgaagtaacctgctatcactgcggagcagactgt
gaagacaccgtcattgttcatgatgataagcccttttgttgtgaaggctgtaaactcgta
tatgagttattacaggaaaacgaactttgcagctactacgatttcaccaaaaatccgggg
gtttcgccggataagaactactacaaaggaaaatatgcgtacctggaccttccggaggtg
catcagcgcatcatccaatttacggacgggcgccaaacgcacgtcaactggtacctgcct
cagatgcactgcagctcgtgcgtgtacctgctcgaaaacctccaccgcttacaggaaggc
gttttttcggccgttgttaattttcccgaaaaacgggtaaggatcatcattgatgaagaa
aagataaaactgagccaactggccgagctgcttacgtatatcggttacgaaccctacatc
agtcttcaggatgtggaatcggaccaatcgcccaagaccaaccgcacgcgtttgtacaag
atcggaattgcgggctttgcctttggcaacgtaatgatgatgagctttcccgattatttc
ggattgggagatacactggccgaccggaacctgcaggtcatgttcagtatattcagcgtc
gtactggcgctgcccgtctttttttacgccgcttccgatttttttgtatcggcttggaaa
gccattcgcaaacattacctgaacatcgacgcccccattgccttggccattttggtcacc
tttgtgcgcagtctgtacgaaatcggcacccaaacgggcgtcgggtacctggattccatg
acaggcattgtgtttttcatgctgttggggcgctactttcaggaaaagacctattcggtc
atttcgtttgaccgcgattataaatcgtactttccggtggccgttacaaaactgggagaa
agtaaaaaggaaaaagaagaaagtgccgatcccaaccaccactcaccggccaccgaccgc
cagattttggttactgatttacaggccggcgataggattttgattcgtaacaaagaattg
attccggccgatgcgcgtctggtcagtgagcgggccatgatcgactatagttttgtatcg
ggcgagtctgagcccgtggaaaaaacccgtaatgagctcatttacgccggcggtcgtcag
gtaggcggagccatcgagctggaaatcacgaaacgggtgtcgcagagttatctgacccaa
ctgtggaacaacgactcctttacacagcaaaaccacaaacaacaacacgatctggtagac
aggatcaatcggtattttacctgggctttattggtactcggccttggtggcttaagtttt
tgggctttatcgggcgatctgccccggggcatcaatgccatcacgaccatcctgatcgtg
gcctgtccgtgtgcgctgctgctttccgatacctttaccaacgggaatattctggggatg
ttcggaaaacataagttttacctcaaaaacgcaaaggtcattgaaagcctctcggaaatt
gacaccgtagtgtttgacaaaacgggtaccctcaccctgccggatgccggccatattcaa
ttcattggcaccccgctcacgcggctccaacaacgcattgtgcgcaccatgtgtgagcag
tcctcgcatccgttgagccggctcattgccaaatcgctcgtgatggttcccaaagaaacc
gccctgaccgattttcaggaagtggaaggaaaaggcattatgtcataccttgggaatcat
tgtaccataaaactgggttccgcggcctttgtcggtctgaaagacgtaccgacgatcgct
tccaactcccacagccgcgtctatttttcgtttgacggccaacaattgggatactacgaa
attcacagtcagtatcgcgaaaatctttcggacacccttcaggcactcaagcttaaaaat
taccaaacgtttcttctttcgggcgacaaaccgacggataccgacgtattgggaaccctg
ttcggggatacaacccacttacattttaaccaaaagcccgaagataaactggcgtttatt
cagcaactgcaacaaaaaggacgtaaagtattgatggtaggcgatggcctcaatgacgcc
ggtgccctggtacagagcaacgtaggcattgcggtctctgacaacgtaaacaatttttct
cccgcctgcgacggtattctggaaggcagtcatctttcgtttctgccccaatacgtacgc
ttggccaaagccggaagacgcattgtggttcagagctttatcatctcggttgtgtacaat
atcatcggcctgagttttgccttaacgggcacattggctccggtcatcgcggcgatcctg
atgccggccagctcgatctccattgtcctctataccacgctggcgagtcgaattgccacg
gcacgtacgctttaa

DBGET integrated database retrieval system