KEGG   Runella slithyformis: Runsl_5245
Entry
Runsl_5245        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51544
Position
complement(6097491..6098255)
AA seq 254 aa
MTVLFFKLTMMPVVIGGITLISRKWGNSIGGIIGSMPWVAGPILVFFILEQGTAFGIRAI
PGILTGVVSLVGFCFCYALVSKRFGWFPTLLSSYSAFVATALVLDALRLSLWSVYGVAVV
SIVTALRRFPLPAAESTPSRRALPPKFDIPFRMLVATLFVLAITTLAKALGPTWSGILTP
FPIITSILAIFTHYLQGSNAAITILKGIMLGLVGFTTFLFLQAFFLREFPIAVSFLLAFV
INALINLAAVRWLR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaccgttttattttttaaactgaccatgatgccggtggtgatcgggggaattaccctg
ataagtcgaaaatggggcaacagcatcggagggattatcggaagtatgccgtgggtagcc
ggtccgattctggtcttttttattttggaacagggaaccgctttcggaatccgtgccatt
ccgggcatcctgaccggggtggtctctttagtgggcttctgtttttgttacgcgcttgtt
tcaaagcgattcggctggtttccgacgctcctgagctcttacagtgcgtttgtggcaacg
gcactggtacttgacgccctgcgcctgtcgctgtggagtgtttacggagtggctgtcgta
agcatcgtgacggccttgcgtcggtttccgctaccggcggctgaaagtactccctcccgc
cgggcactgccccccaagtttgacattccttttcgaatgctggtagccaccctttttgta
ttggccattacgaccctcgccaaagccttagggcctacgtggagcggtatcctgactcct
tttccgatcattacctccattttagccatttttacgcattatttacagggaagtaacgcg
gccattacgatcctgaaaggcatcatgctcgggcttgtcgggtttacgacgtttctgttt
ttgcaggccttctttcttcgggaattcccgatcgccgtgtcctttttgctggcctttgtg
atcaatgccctcatcaacttggcggcggtcagatggttgcgttaa

DBGET integrated database retrieval system