KEGG   Runella slithyformis: Runsl_5246
Entry
Runsl_5246        CDS       T01553                                 

Definition
(GenBank) cytochrome oxidase maturation protein, cbb3-type
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: FixS NTP_transf_6 DUF3951
Other DBs
NCBI-ProteinID: AEI51545
Position
6098539..6098703
AA seq 54 aa
MSALILLLSVSLLVAAGFLVAFVWSVKKGQYDDDYTPSVRILFDDNEKKSFPQS
NT seq 165 nt   +upstreamnt  +downstreamnt
atgagtgctcttatccttctcctttccgttagcctgctggtcgcagcaggattcctggtc
gcctttgtgtggtcggtcaaaaagggacaatacgacgacgattacacgccctccgtccga
attttgttcgacgataatgaaaaaaaatcatttcctcaatcataa

DBGET integrated database retrieval system