KEGG   Runella slithyformis: Runsl_5247
Entry
Runsl_5247        CDS       T01553                                 

Definition
(GenBank) cytochrome c oxidase, cbb3-type, subunit I
  KO
K15862  cytochrome c oxidase cbb3-type subunit I/II [EC:7.1.1.9]
Organism
rsi  Runella slithyformis
Pathway
rsi00190  Oxidative phosphorylation
rsi01100  Metabolic pathways
rsi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Runsl_5247
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Runsl_5247
Enzymes [BR:rsi01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     Runsl_5247
SSDB
Motif
Pfam: COX1 FixO
Other DBs
NCBI-ProteinID: AEI51546
Position
6098722..6100869
AA seq 715 aa
MEPISKTTATVEMEEFAYDNVIVRNFAIASIVFGIVGMLVGVLIAFQLAFPALNFDISYT
TFGRLRPLHTNAVIFAFVGNGFFMGLYYSAPRILRTPMWSPLLSKINFWGWQLIIVAAAI
TLPLGLTTGKEYAELEWPIDIAIALVWVAGLVNLVMTMVNRRVQHIYAAIWFYLASFVTV
AMLHVVNSVELPISLTKSYSWYAGVQDALVQWWYGHNAVAFFLTTPYLGLMYYFLPKAAN
RPIYSYRLSIVHFWSLIFLYIWAGPHHLLYTSLPDWAQSLGTVFSVMLIAPSWGGMINGL
FTLRGAWDKVREDVVLKFMVVAVTAYGMATFEGPMLSLKNVNAIAHYTDWIVAHVHVGAL
GWNGFMTFAIMYWLFPKMYGRPLYSIKLANFHFWIGTLGIIFYAVPMYWAGWTQSSMWKE
FTEEGFLKYPNFLETVTQLVPFYILRGFGGTLFLVGFLVGAYNLMMTALGGKLIRKETAR
SASLASIWHQPANEFWHSRIFERKPVLLTVIALVAVIIGGVIELVPTFMVKSNVPTIESV
KPYTALELHGRDIYVREGCYTCHSQMIRPFRSETERYGEYSKAGEFVYDHPFQWGSKRTG
PDLHRVGAKYPDSWHYNHMEDPTSMSPGSIMPKYPWLIEDELDLSTTRAKISAMQTLGVP
YEAGYEEKATADAQEQAKQIAANLKKDGIKAKSNTEIIALIAYLQRMGTDIKAAQ
NT seq 2148 nt   +upstreamnt  +downstreamnt
atggaaccaatttccaaaacgaccgctactgttgaaatggaagagttcgcctacgataac
gtcattgtacggaactttgccattgcctctatcgtgtttgggatagtcggcatgttggta
ggtgtgctcattgcttttcagctggcatttcctgccctcaattttgacatatcgtacact
accttcggtaggctacgtccactgcacaccaatgccgtgatttttgcctttgtgggcaac
ggcttttttatggggctttattattcggccccccgtattctccgcaccccgatgtggagc
ccattattgagtaaaatcaacttttggggctggcagttgattatcgtcgcggcggccatc
accctcccgctcgggcttaccaccgggaaagaatacgccgaattggaatggccgatcgat
atcgccattgcactggtatgggtagccggtttggtcaacctggtcatgaccatggttaac
cgtcgggtgcagcatatctacgcggccatctggttttatttggcctctttcgtaaccgtt
gccatgcttcacgtggtcaacagcgtagaattgcccatttcacttacaaagagttattcc
tggtatgccggggtgcaggatgcactggttcagtggtggtacggtcacaatgcggtggct
ttcttcctgaccacgccttacctgggtctgatgtattatttcttacccaaagccgccaat
cgtcccatttattcgtatcgcctttccattgttcacttctggtcgctgatcttcctgtat
atctgggccggtcctcaccacttactgtatacttcattgcccgactgggctcaatcgctc
ggaaccgtattttcggtcatgctgatcgcaccttcctggggcgggatgatcaacggactc
tttaccctgcgcggtgcctgggataaagtgcgggaagatgtggtgttgaaatttatggtt
gtggccgtaacggcctacgggatggccacttttgaaggaccgatgctttccctcaaaaac
gtcaacgccattgctcactataccgactggatagtagcgcacgttcacgtaggggctttg
ggctggaacggatttatgacctttgccatcatgtactggttgttccccaagatgtacgga
cgtcctttgtactcgatcaaactggccaatttccacttctggatcggcaccttgggtatc
attttctacgccgttccgatgtattgggccggttggacacaatcttcgatgtggaaagaa
tttacggaagaaggtttcttaaaataccctaacttcctcgaaaccgttacgcagctcgtt
cctttctacatattgcgcggcttcggcggaaccttattcttagtcggtttccttgtgggg
gcgtataacctcatgatgacggccttaggcggcaaattgatcagaaaagaaaccgcgcgc
tccgcttcgttggcttccatctggcatcagcccgccaacgaattctggcacagccgtatt
ttcgaacgcaaaccggtactcttgaccgtcattgccttggtggcggtgatcatcggtggt
gtgatcgaattggttccgaccttcatggtcaagtccaacgttccgaccatcgaaagtgta
aaaccatacacagccctcgaattgcacggtcgcgatatctacgttcgggaaggctgctat
acctgccactcgcagatgatccgtccgttccggagtgaaaccgagcgctacggtgaatac
tcaaaagccggcgagtttgtctatgaccaccccttccaatggggctcaaaacgtaccgga
cccgatctgcaccgcgtaggtgccaagtaccccgattcatggcactacaaccacatggaa
gaccccaccagtatgtcgccgggctctatcatgcctaagtacccctggctgatcgaagat
gaacttgatctaagcaccactcgagcgaagatcagcgccatgcagacactgggcgttcct
tatgaagccggctacgaagaaaaagccaccgccgatgcacaggaacaggccaaacagatt
gcggcaaacctcaaaaaagacggcataaaagcgaagtccaacaccgaaatcattgccctg
atcgcgtacctgcaacgaatgggaaccgatatcaaagcagctcaataa

DBGET integrated database retrieval system