KEGG   Runella slithyformis: Runsl_5248
Entry
Runsl_5248        CDS       T01553                                 

Definition
(GenBank) cytochrome c class I
  KO
K00406  cytochrome c oxidase cbb3-type subunit III
Organism
rsi  Runella slithyformis
Pathway
rsi00190  Oxidative phosphorylation
rsi01100  Metabolic pathways
rsi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Runsl_5248
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Runsl_5248
SSDB
Motif
Pfam: FixP_N Cytochrome_CBB3 Cytochrom_C FixQ Cytochrom_C550 CrgA
Other DBs
NCBI-ProteinID: AEI51547
Position
6100931..6101992
AA seq 353 aa
MKFRNYLQAIDGVAIYPLIGLLIFTGLFVGLVWYLIRMDKQTVQKMSRLPLEDGTVRNIL
STLLLLFVSSGAFAQAEVEKAGNKELVTYLIMLILLLVILAVVAVLIQVLLLLQKISAKT
QPAEAPAEDLRGDKAPLFSARWWQRWTGFGVQLEDEQRILITGHDYDGIHELDNRMPPWL
AFLFQGTILFAIIYLLIYHLTGMGDLPMAELEKETLVIEAKKTAFLEKAAAKINENTVAL
LSDAKTIEEGKSVFMANCAACHANDGGGTVGPNLTDEYWLHGGGIKNVFKTIKYGVPQKG
MISWEKQLNPLKMQQVASYIISIKGSKTANPKAPQGEVYTETAAKTDSTVAMK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaaattcagaaactacctccaggcaatcgacggagtggccatctatccgctcattggg
ctgctcattttcaccggtctttttgtaggtttggtgtggtacctaattcgtatggataaa
caaaccgtccaaaaaatgagtcgacttccgctggaagacggcaccgttcgaaacatactt
tctacccttctgctgctttttgtcagttcgggggcttttgctcaggctgaagttgaaaaa
gccggcaataaagaattagtaacctacctcattatgctgatcctgttattggtcatcctt
gcggtagtggcggttttgattcaggtgttgctgttactccaaaaaatctccgctaaaacc
caacccgccgaagcaccggcggaagacttacgcggcgataaagccccgctgttcagtgcc
cgttggtggcagcgttggaccggcttcggcgttcaactcgaagacgagcagcgtatcctc
atcaccggtcacgattacgacggcatccatgagctcgacaaccgtatgccgccctggctg
gcctttcttttccagggcactattctatttgccatcatctatttacttatttatcacctt
accggaatgggcgatcttccaatggctgaactggaaaaagaaacgttggtcattgaagcc
aaaaaaacggcttttctggaaaaagcagccgctaaaatcaacgaaaacaccgtcgctctg
ctttcggatgccaaaaccattgaagaaggaaaaagcgtttttatggccaattgcgcggcc
tgtcacgccaacgacggtggcggtaccgtaggccctaacctgacggacgagtattggctg
cacggcggcggcatcaaaaatgtattcaaaaccatcaagtacggggtgcctcaaaaaggg
atgatctcgtgggaaaaacaattgaatccgctcaagatgcaacaggtagccagctatatc
atttcgataaagggctcaaaaacggctaatccgaaagctccgcagggagaagtttacaca
gaaactgccgccaaaacggacagtaccgtagcaatgaaataa

DBGET integrated database retrieval system