KEGG   Runella slithyformis: Runsl_5249
Entry
Runsl_5249        CDS       T01553                                 

Definition
(GenBank) cytochrome c oxidase accessory protein CcoG
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Fer4_18 FixG_C Fer4_5 Fer4_7 Fer4_9 Fer4_8 Fer4_17 Fer4_16 Fer4_10 Fer4 Fer4_21 Fer4_6 Fer4_4 Fer4_3 Fer4_13
Other DBs
NCBI-ProteinID: AEI51548
Position
6102064..6103476
AA seq 470 aa
MNSLETPHDIDDSFRDNFAAVDNTTGKRNWFFPQKPTGKWHNRRVWFTIFQLTVMFGLPF
LKVNGQPLFLFNILERKFIIFGLFIGPQDYWLFGLMMISFFVFIVLFTTVFGRVWCGWAC
PQTVFMEMVFRKIEYLIEGDWKAQRALDKAPWNNEKIIKRALKAVVFLAISFLIANLLLS
YFVGIDRLEKIIIEPVSEHLTLFLGIVAFTVVFFWNFAWLRDQACTVVCPYGRLQGVLLD
KNSVVIAYDYKRGEPREKLHKGKERTAGDCISCYQCVNVCPTGIDIRNGTQMECVNCTAC
IDACDNIMEKVNLPKGLIRFDSENNIASGKSKLITTRTIGYAVVLTALWVALGYAILTRD
DTETTMLRVPGSRYIENPDGSISNLYTFKLFNKTNHGINPDMRILFPKGTLKFAGIPNLH
LDGAGMVEGSVFITIPKSEIPGRRTEVKLAIYAGNEKLEEFKTTFIAPEE
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgaactcccttgaaacaccccacgacattgacgattcatttcgcgataattttgcggcg
gtagacaatactaccggcaaacgcaactggtttttcccgcaaaaaccaacgggaaaatgg
cacaatcgccgcgtgtggtttacgatctttcaactcaccgttatgttcgggctgcctttc
ctcaaggtcaacgggcagcccttgtttcttttcaatattttagaacgcaaattcatcatc
ttcgggctcttcatcggaccgcaggattattggctgtttgggctgatgatgatttccttc
tttgtgtttattgtactgtttaccaccgtcttcggacgagtttggtgcggatgggcgtgt
ccgcaaacggtcttcatggaaatggtcttccgtaaaatcgaatacctgatcgaaggagat
tggaaagcacagcgcgccttggacaaagctccctggaacaatgaaaagatcataaaaaga
gcgctgaaagccgtggtatttctggccatttcgtttttgatcgccaatcttcttctcagc
tatttcgtcggcattgaccgactggaaaaaatcatcattgagcccgtttctgagcacctg
acactcttcctgggcattgtggcatttaccgtcgttttcttttggaacttcgcatggctg
cgtgaccaagcctgtaccgtggtttgcccttacggacgtttgcagggcgtattgttggat
aaaaattcggtcgttattgcctacgattacaaacgcggtgagccccgcgaaaaactgcac
aagggcaaagagcgtactgccggcgactgcatcagttgttatcagtgcgtcaatgtctgc
cctaccggcatcgacattcgcaacggtacgcagatggagtgtgtcaattgtaccgcctgc
attgacgcctgcgataacatcatggagaaagtcaatttgcccaaaggactgatccgtttt
gactccgaaaacaacattgccagcggcaaaagtaaactgatcacgacccgcaccattggg
tacgcggttgttttaaccgctttgtgggtagcgttgggctacgccattttgacccgagac
gacaccgaaactaccatgctgcgggtgccgggctcccgttatattgaaaaccccgacggc
agcatcagcaatctgtataccttcaaactgttcaataaaaccaatcacggcatcaacccc
gacatgcgaattttgtttcccaaaggaaccttgaaatttgccgggattcccaatctgcat
ttggatggcgcgggtatggtcgaaggatccgtatttatcacgattcccaagtcggaaatt
cccggccgcagaacggaggtaaaactggccatctatgccggaaatgaaaaattggaagaa
tttaaaacaacctttattgcaccggaagaatag

DBGET integrated database retrieval system