KEGG   Runella slithyformis: Runsl_5250
Entry
Runsl_5250        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: FixH
Other DBs
NCBI-ProteinID: AEI51549
Position
6103532..6103966
AA seq 144 aa
MKISWGTGIWVLYGSFVLMMVTMVGMSVVQKIDLVTDDYYAEEIKYQGKIDKVRNAGQLA
APLAWEVTPTEIKVNYPSALKNISGFIYFYCPSDNRKDFKLPIKTDLQLIQRIPTQNIPS
GRYRIQFDWQANGTGYWNEGIINI
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaaaatatcctggggtaccggcatttgggttctatatggctcatttgtcctgatgatg
gtcacgatggtcggcatgagtgtcgtccaaaaaatagatctggtgaccgacgattattac
gctgaagaaattaaataccagggaaaaatcgataaggtcagaaacgccggacaattggcg
gctccgttggcgtgggaagtgaccccgaccgagataaaggtcaactatccttcagcgtta
aaaaacatcagcggtttcatttatttctattgcccttccgataaccggaaagacttcaaa
ctgcccatcaagaccgatctgcaacttattcagcgtattcccacgcaaaatatcccaagc
ggtcgttaccgtattcagttcgactggcaggccaacggcaccggctattggaacgaagga
attataaatatttga

DBGET integrated database retrieval system