KEGG   Runella slithyformis: Runsl_5251
Entry
Runsl_5251        CDS       T01553                                 

Definition
(GenBank) integral membrane protein
  KO
K09792  uncharacterized protein
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Runsl_5251
SSDB
Motif
Pfam: DsbD_2
Other DBs
NCBI-ProteinID: AEI51550
Position
6104104..6104799
AA seq 231 aa
MLYLAFTLGLMSSLHCVGMCGPIALALPVHHRSTFGKLLGILMYNAGRATTYSLLGVLFG
LVGSALDFGGIQRGLSIGTGIILLGTVAYSSHWIDQLSAPLPLQKGVQWVKKRLGLLLSR
RSFPALFLLGTLNGLLPCGLVYMALISSIAMGNPWEGGLFMALFGAGTLPAMSAVAFVKT
FISTKFRNQARRLMPAFVAVVAILLIVRGFQFSESPSGAKTARPIPVCHGE
NT seq 696 nt   +upstreamnt  +downstreamnt
atgctctatctcgcattcaccttaggcttaatgagcagtctccactgtgtggggatgtgc
ggacctattgcgttggcattgccggtacatcatcgctcaacgtttgggaaactgctgggg
attttgatgtataacgccggccgcgccactacctacagcttgcttggagtgctgtttgga
ttggtgggcagcgcgcttgacttcggaggcatacagcgcggattatccattggtaccggc
attattttgctcggcaccgtcgcctattcctcgcattggattgatcagctctccgctccg
ctccctttgcaaaaaggtgttcaatgggtcaaaaaaagactggggctgttgctttcccga
cgcagttttcccgcgttgtttttattgggaacgcttaatgggttattgccttgtgggttg
gtctacatggctcttatcagttctattgccatgggcaacccttgggaaggcggcctgttt
atggcgttattcggggcgggcacccttccggccatgagtgccgtggcgtttgtaaaaacc
tttatttccaccaaattcagaaaccaagcccgtcggcttatgcctgcctttgtggccgtc
gtggcgattctcctaattgtccgcggttttcaattttccgaaagtccttcaggggccaaa
acagcccgtccgattcccgtctgccacggagaatag

DBGET integrated database retrieval system