KEGG   Runella slithyformis: Runsl_5253
Entry
Runsl_5253        CDS       T01553                                 

Definition
(GenBank) PAS/PAC sensor signal transduction histidine kinase
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: HATPase_c PAS PAS_9 HisKA PAS_4 PAS_8 TBK1_CCD1 PAS_7 PAS_3 SPT16
Other DBs
NCBI-ProteinID: AEI51552
Position
6106504..6107742
AA seq 412 aa
MLEVFIQQTQAMRRHVEMLHALFKSATEGIIVIDSWGEIQLVNPKAQELFGYEEGELLGK
KIETLIPQKYARRHVDHRMNYAQQPKARNMGGHFDLQAKRKDESEFPVEVSLSPFSTSDG
DYVVSFIIDISLRKSQETALLEANRQIQNLNTDLEERVQQRTRELARALEELELSKQEVM
RALEKERQLNDMKTKFVTIASHEFRTPLATILSSASLIGRYSLSEEEDKRQKHVQRIKST
VNNLTEILNDFLSLGKLEEGQIRNVPVVFNLPEFCRELIDELRSVCKENQHVQYSHEGEA
EVCIDRHLLKNVFINLISNAAKYSGEGKDIYLKTHKNATKLTVEIQDRGIGISEQDLPYV
FDRFFRAQNSGTIQGTGLGLNIVYKYIQLMQGDIRMESKLNEGTKVYLELPT
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgttagaagtatttattcagcaaacccaagcgatgagaagacacgtcgaaatgttacat
gcactcttcaaaagtgcaacagaggggataattgtgattgattcatggggagaaattcaa
ttggtaaatccaaaagcacaggagttgtttggatacgaagaaggagaattgcttggaaag
aaaattgaaaccctgatccctcaaaagtatgcaaggaggcatgttgatcaccgtatgaat
tacgcccagcaacccaaagcgcgaaacatggggggccattttgatttacaggccaaacgt
aaagacgaaagcgagtttccggtcgaagtcagtctgagtccgttcagtaccagtgacgga
gattatgtcgtcagctttatcattgatatctccctgcgcaaatcacaggaaacggccctg
ctcgaagccaatcgccaaattcaaaacctgaataccgatctggaagaacgggtccaacaa
cgtacccgtgaattggcccgcgccctggaagaacttgaactgtcaaaacaggaggtaatg
cgtgcgctcgaaaaagaacggcaactcaatgacatgaaaaccaaatttgtgaccattgct
tcgcacgaattccgtacgcccttggccactattttatcttccgcttctttaattggccgt
tattctctcagcgaagaagaagacaagcgtcaaaaacacgtacagcgcattaaatcaacg
gtcaataatctgaccgaaatcctgaatgatttcctgtctttggggaaattggaagaaggt
caaatccgaaatgttcccgtggtgtttaacctgcctgaattctgtcgggagctgattgat
gagctccgttcggtttgcaaagaaaaccagcatgttcagtatagtcacgaaggagaagcc
gaagtatgcattgatcgtcacttactgaaaaacgtcttcatcaaccttatctcaaatgcc
gcgaaatactccggcgaaggaaaagatatttatttgaaaacccacaaaaacgcgacaaag
ctaacggtcgaaattcaggaccggggtatcggaatatctgaacaggatctgccttatgtc
tttgaccggtttttcagagcccaaaattcgggcaccattcagggcaccggattgggactc
aatattgtgtataaatacattcagttaatgcaaggagatatccggatggaaagtaagctg
aatgaaggcaccaaggtgtatcttgaactccccacatag

DBGET integrated database retrieval system