KEGG   Runella slithyformis: Runsl_5255
Entry
Runsl_5255        CDS       T01553                                 

Definition
(GenBank) ABC transporter related protein
  KO
K06158  ATP-binding cassette, subfamily F, member 3
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rsi03012]
    Runsl_5255
Translation factors [BR:rsi03012]
 Eukaryotic type
  Initiation factors
   Initiation associated factors
    Runsl_5255
SSDB
Motif
Pfam: ABC_tran ABC_tran_Xtn ABC_tran_CTD AAA_21 SMC_N AAA_29 MMR_HSR1 NACHT MYO10_CC AAA_18 RsgA_GTPase AAA_15 AAA_28 AAA_13 PDGLE AAA_23 Allexi_40kDa PilJ DUF2443
Other DBs
NCBI-ProteinID: AEI51554
Position
complement(6108905..6110845)
AA seq 646 aa
MISITNLSYYLGDRALYENASLHIKPKDKIGLIGLNGTGKSTLLHLIVGNYQPDAGHISK
SGGCTIGFLNQDLLSYQSDDSILSVAMQAFERANELQRQMDAVIHEMEVNYQDKLVDRLA
RIQEEFEALDGYSIQSKAEEILEGLGFSTADLQKPLRLFSGGWRMRVMLAKLLLQKPSLL
MLDEPTNHLDLPSIQWVEKYVQSYENAVIVVSHDREFLDNVCDTMVEVSNQKLNYYGGNY
SFYIEEKALRNEIQKGAYENQQAKIRQTERFIERFKAKATKAKQAQSRAKMLDRMDRVEA
VVDENAKVHFRFQFTTQPGRHVLQLENVSKAYGEKEILRNTGIAMERGDKIALIGANGKG
KSTLLRVIAGTEPIEGERRLGHNVLFTFYAQHQLESLNIEHTILEELKYANPTKSETECR
TILGCFLFTGEDVFKKIKVLSGGEKSRVALAKVLVSEANFLLLDEPTNHLDMQSVNILIQ
ALRQYEGSFVVVSHDRFFVEAIANKIWYIDNREVKEYPGTYQEYEWWQEERGEEENAKGK
EAVMTSLASMNAIKTAPAVAPAPTKNGNSNNQALKQLQNKVNQLEKEIDALEKQKAEIES
TLADEAIYSNPDKLTEVNRQYADIKQKIDKATEDWEQAVLEADALA
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgatttcaataactaacttatcgtattacctcggcgaccgagcgttgtatgaaaacgcc
tcgcttcacatcaagcctaaagacaaaatcggccttatcgggctgaacggaacgggcaag
tcgacgttgttgcacttaattgtaggaaattatcaacccgatgccgggcatatctcaaaa
tcaggcggttgtacgatcggatttttgaatcaggatctgctttcctatcaaagcgacgac
tctattttgtcggtagcgatgcaggcctttgagcgcgccaacgaactgcaacggcagatg
gacgcggtcattcatgaaatggaagtaaattatcaggacaaactcgtggatcgtcttgcc
cgtattcaggaagagtttgaagccttggatggctattccatacagtcaaaagcagaagag
attctggaagggctcggtttttcgacggctgatctgcaaaaaccactacggcttttttcc
ggagggtggcgtatgcgggtgatgctggcgaaattgctgctgcaaaaaccctcacttctg
atgctcgatgagccgaccaaccacttggaccttccttcgattcagtgggtggaaaaatac
gttcagagttatgaaaatgccgtgatcgtggtttctcacgaccgtgaatttttggataat
gtctgcgatacaatggtggaagtgagtaaccaaaaactgaattattacggcggcaattat
tccttttacatcgaagaaaaagccctgcgtaacgaaattcaaaaaggcgcttacgaaaac
caacaggctaaaattcggcaaacggagcgttttattgagcgctttaaagcgaaggctacc
aaggccaagcaggcccagagccgcgccaaaatgctggatagaatggaccgcgtggaagcc
gtcgtggatgaaaacgccaaagtccattttcgatttcagttcaccacccaaccggggcgt
catgtactccagcttgaaaatgtatcaaaagcctacggagagaaagaaatcctgcgcaat
accggcattgccatggagcgtggggataagatcgccctcatcggggccaacggaaaagga
aaatcgacgcttctgcgggtgatcgcaggcaccgaacccattgaaggcgagcggcgttta
ggacataatgtgctgtttacgttttatgcccagcatcagttggagtcgttgaacatcgaa
catacgattctggaagagttgaaatatgccaacccgaccaaaagtgaaaccgaatgccgt
accattttgggatgctttctgtttacgggcgaggatgtatttaaaaagataaaggtactt
tcgggaggagaaaaatcgcgcgtggcgttggctaaagtgttggtgtcggaggcgaacttt
ttattgcttgatgagcctaccaaccacttagacatgcaatcggtcaatatcctgattcag
gcgttgcgccaatacgaggggtcgtttgtagtggtatcgcacgaccgcttctttgtggaa
gccattgcgaataaaatttggtatatcgacaaccgcgaagtgaaagaataccccggcacg
taccaggaatacgaatggtggcaggaagaacggggagaggaagaaaatgccaaaggcaaa
gaagccgtcatgacgagtttagcctccatgaatgcgatcaaaaccgccccggccgttgcc
cccgccccaacgaagaatggaaactcgaacaaccaggcactgaagcagcttcagaataaa
gtcaatcaacttgaaaaggagatcgacgccctggaaaagcagaaagcagagatagaaagt
acgttggcggatgaagctatctacagcaatccggacaagttgacggaggtcaaccgtcaa
tacgctgacatcaagcaaaaaatagataaagcaacggaagactgggaacaggccgtactc
gaagccgatgcgttggcgtag

DBGET integrated database retrieval system