KEGG   Runella slithyformis: Runsl_5256
Entry
Runsl_5256        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Acetyltransf_6 FemAB
Other DBs
NCBI-ProteinID: AEI51555
Position
6111101..6112102
AA seq 333 aa
MSYSIPQQKVTSFPLRDYTAQVVENNPDVLHRYHIRWALWLFNTPLHVKHQHAAEVYTFI
LTDTATQTEVFGVFHLFIEHRQGISPFQASFGSFEMAERISHAEFGEWLTGIELFAKELG
LSSLCIKHYPSCYNPSRTTFIRRGLTRHGFTIPSSTENQFIPVIQDRFEEGLHASERRRL
RKCLRAGFRFEEWLNPPAEEVYRFIEHNRQLLGYALSFSFEQLQLWLSVFPDHFRVFCVK
DGDTLASLTLTVRVGESVLYNFCPADNLTYRTYSPTVLLTKGLYEECRHKGISLLDLGIS
VNETGAPKPSLKRFKENLGAKNCDKYVFHKVLS
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgtcctattcgatcccccaacaaaaggtgacgtctttccccctgcgcgactataccgca
caggtcgtagagaataaccccgatgtactgcaccgatatcatatccgctgggcgttgtgg
ctctttaacacgcccttacacgtaaaacatcaacatgcggcggaggtctatacctttatt
ctgaccgataccgccacccaaaccgaagtattcggggtttttcatttattcattgaacac
cggcagggaatcagtccttttcaggcgtcgtttggttcttttgaaatggccgagcgcatc
agtcatgccgagtttggcgaatggctgacgggcatcgaactgtttgcgaaagaactcggt
ctctcaagcctttgtatcaaacactacccttcctgctacaacccatcacggactacgttt
atccgccgagggttgacgcggcatggctttactatacccagcagtactgaaaaccagttc
attcccgtcattcaagaccgctttgaagaaggactgcacgcttccgagcgccgccgtttg
cgcaaatgcctgcgggccggttttcgttttgaagaatggctaaatccacctgccgaagaa
gtctatcgatttattgaacacaatcgccagctgttagggtatgcactctcattcagcttt
gagcaactgcaattatggctgagcgtattccctgaccattttcgcgttttttgcgtcaaa
gacggtgatacattggcctctcttaccctgacggtgcgcgtgggggaatctgtactgtat
aacttctgccctgccgacaacctcacatatcgtacctatagcccgacggtattgcttacc
aaaggcctgtacgaagaatgccggcacaaaggtatttcgctgttggatttgggcatctcc
gtcaacgaaacgggtgctccgaagccaagcctgaagcgattcaaggaaaatctgggcgca
aaaaactgcgacaaatacgtttttcacaaagtgttatcctaa

DBGET integrated database retrieval system