KEGG   Runella slithyformis: Runsl_5257
Entry
Runsl_5257        CDS       T01553                                 

Definition
(GenBank) Glutaminyl-tRNA synthetase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
rsi  Runella slithyformis
Pathway
rsi00970  Aminoacyl-tRNA biosynthesis
rsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Runsl_5257
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rsi01007]
    Runsl_5257
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsi03016]
    Runsl_5257
Enzymes [BR:rsi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     Runsl_5257
Amino acid related enzymes [BR:rsi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Runsl_5257
Transfer RNA biogenesis [BR:rsi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Runsl_5257
 Prokaryotic type
   Other AARSs
    Runsl_5257
SSDB
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C
Other DBs
NCBI-ProteinID: AEI51556
Position
complement(6112160..6113893)
AA seq 577 aa
MRPNYTTFAHYYQSQHHMSEINKESTEEKSLNFIEQIIEEDLRNGKHGGRVLTRFPPEPN
GYLHIGHAKSICLNFGVAQKYGGGTNLRFDDTNPVTEDTEYVDSIKNDVQWLGFQWVNEF
YASDYFDSLYEYALRLIRKGLAYVDESTSEEMAVMKGTPTEPGTNSPYRDRTPEENEDLF
VRMKNGEFAEGTRTLRAKIDMAAPNMIMRDPVIYRIKFAHHHRTGDKWCIYPMYDFAHGQ
SDSIEKITHSICTLEFVPHRDLYDWCIENLEIFPSKQYEFARLNLTYTVMSKRKLLQLVN
EQYVTGWDDPRMPTISGLRRRGYTPESIREFCDRIGVARRDNLIDVSLLEFCVREHLNKV
AERRMVVLDPLKVIITNFPEGKVEICHSENNPEDPNGGMREIPFGRELYVERDDFMEVAP
KKYFRLAPGQMVRLKGAYIIRCDDFVKDEAGNVTELHCSYIENSKSGNDTSGINVKGTLH
WVSVNEALPIEIREYDRLFSVEDLSAAEGDFKDHINPNSLQVITGYAEPALKEAAVGAKF
QFMRKGYFCLDRDSTDEHLVFNRTVGLKDTWGKVAAK
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgagaccgaattatactacttttgcgcattactaccagtcacaacaccacatgagtgaa
attaacaaagaatccaccgaagaaaagtcacttaacttcatcgagcaaatcatcgaggaa
gacctccgtaacggtaaacacggaggccgagtactgacgcgctttcctcccgagcccaac
gggtatctgcacattggtcatgccaaatccatatgccttaattttggcgtagcgcagaaa
tatggcggagggaccaatcttcgttttgacgatactaatccggtcacggaagataccgaa
tacgtcgattccatcaaaaatgacgtgcaatggttgggatttcagtgggtaaatgaattt
tacgcttccgattatttcgattctttgtacgaatatgcgcttcgtctgattcggaaagga
ctggcgtacgtggatgagtccacttcggaagaaatggctgtcatgaagggaacgccaacc
gagcccggcaccaacagtccctaccgtgaccgtacgcccgaagaaaatgaagatctgttc
gttcggatgaaaaacggagagtttgcggaaggaacccgcacactccgggccaaaattgac
atggcggcacccaatatgatcatgcgtgaccccgtcatttatcgtatcaaatttgcgcat
catcaccgtacgggcgataaatggtgcatttatccgatgtatgattttgcgcacgggcag
tcggattccatcgaaaaaataacgcactcgatctgtactctcgaatttgtgcctcaccgc
gacctgtacgattggtgtattgaaaatctggagatatttccgtcaaaacaatacgagttt
gcgcgtctgaatctgacctacacggtcatgagtaagcgaaaactccttcaattggtcaat
gagcaatacgtaacgggctgggatgatccgcgtatgccgaccatttcggggttgcgtcgc
cgcggctacacgcccgagtccattcgggagttttgcgatcgtatcggcgtggcgcggcgc
gataatctgatcgatgtgagcttgctggagttttgtgtgcgtgaacaccttaataaagtc
gcggagcgccgcatggtggtacttgatccgctcaaagtgatcattaccaatttccccgaa
ggaaaggtggaaatctgccatagcgaaaacaatcccgaggatcccaacggaggtatgcgc
gagattcctttcgggcgtgagctgtacgtagagcgggatgattttatggaagtggcccct
aaaaaatattttcgtttagctcccgggcaaatggtccgcctgaaaggtgcgtacatcatc
aggtgtgacgacttcgtcaaagatgaagccggcaatgtgaccgaactgcattgctcatac
attgaaaacagcaaaagcggtaacgatacctcaggcatcaacgtgaaaggaaccctgcat
tgggtatcggtcaacgaagccctgcccatcgaaattcgggaatacgaccgtctgttcagc
gtcgaagacctttcggcggccgagggagattttaaagatcatattaaccccaattcgttg
caggtcattacgggctatgccgaaccggccctgaaagaagccgcagtaggggcgaagttc
caattcatgcgcaaaggatatttctgcctggaccgtgattctaccgatgagcatttggtc
tttaatcgtaccgttgggctgaaagatacgtgggggaaagtcgcggcgaaataa

DBGET integrated database retrieval system