KEGG   Runella slithyformis: Runsl_5258
Entry
Runsl_5258        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: CD20 Adeno_E3_CR2 PsbI DUF4199
Other DBs
NCBI-ProteinID: AEI51557
Position
6113972..6114238
AA seq 88 aa
MNNTLKFAIYIVVFSFICPVGEKLLGYQNTIVDRLPFTCLLWLILVGVFYIFFYKKTRRN
SPKATYQTNVRSSLLLSICRPAGFAAVK
NT seq 267 nt   +upstreamnt  +downstreamnt
atgaacaataccctcaaatttgccatttacattgttgttttcagttttatttgcccggta
ggagaaaaattactcggctatcagaatacgatcgtcgaccggcttccgttcacctgtctg
ctttggttgatcttggtcggcgtattctacattttcttttacaaaaaaacacgccgaaac
tccccaaaggcaacttaccaaaccaatgtacgttcatcactgcttctgagtatctgccgg
ccggccggctttgccgctgtaaaatga

DBGET integrated database retrieval system