KEGG   Runella slithyformis: Runsl_5259
Entry
Runsl_5259        CDS       T01553                                 

Definition
(GenBank) 6-pyruvoyl tetrahydropterin synthase and hypothetical protein
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
rsi  Runella slithyformis
Pathway
rsi00790  Folate biosynthesis
rsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Runsl_5259
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsi03016]
    Runsl_5259
Enzymes [BR:rsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     Runsl_5259
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     Runsl_5259
Transfer RNA biogenesis [BR:rsi03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Runsl_5259
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-ProteinID: AEI51558
Position
6114698..6115114
AA seq 138 aa
MSNQRVAVFRKTHFNAAHRLNNPAWSEEENARIFGKCNLPNYHGHNYELIVRVTGEVDPQ
TGYVVDLKWLNDLIELNVLQKFDHKNLNLDTEEFRYLNPSAENIAIVIYNILRGHLQSTL
DLKIRLYETERNFVEYPA
NT seq 417 nt   +upstreamnt  +downstreamnt
atgagcaatcaacgagtggcggtctttcgaaagacccacttcaatgctgcgcaccgactc
aataatccggcgtggtcggaggaggaaaacgcacgcattttcggaaaatgcaatttgccg
aattaccacggacacaattacgagttaatcgtccgggtaacgggggaagtagaccctcaa
accggctacgtcgtggatttgaaatggttgaacgacttaatagagctcaatgttctgcaa
aagttcgaccacaaaaatcttaaccttgacacagaagagttcagatacctgaatcccagt
gccgagaatattgcaatcgtgatttataacatcctgcgtgggcacttacaatccacatta
gatttgaaaataagactatatgaaaccgaacgaaactttgtggaataccccgcgtga

DBGET integrated database retrieval system