KEGG   Runella slithyformis: Runsl_5260
Entry
Runsl_5260        CDS       T01553                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rsi  Runella slithyformis
Pathway
rsi00790  Folate biosynthesis
rsi01100  Metabolic pathways
Module
rsi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Runsl_5260
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Runsl_5260
SSDB
Motif
Pfam: GTP_cyclohydroI QueF
Other DBs
NCBI-ProteinID: AEI51559
Position
6115077..6115772
AA seq 231 aa
MKPNETLWNTPREAADFVDLTIDEWGDDHSLSAYETPMREDAFELSDVEKVTKIEQHFKA
IMETLGLDLTDDSLKGTPHRVAKMYVKEIFSGLNPKNKPKATLFENKYNYNEMLVEKDIS
FYSNCEHHFVPIFGKAHVAYISSGKVIGLSKLNRIVQYFAKRPQVQERLTIQIGKELQQI
LQTEDVAIVMDAKHLCVASRGVQDDTSTTITSFYGGKFKEEATKNEFLKYL
NT seq 696 nt   +upstreamnt  +downstreamnt
atgaaaccgaacgaaactttgtggaataccccgcgtgaggctgccgatttcgttgatttg
accattgacgaatggggcgacgaccatagcctgagtgcgtatgaaactcccatgcgcgaa
gatgccttcgagctgagcgatgtagagaaagtaaccaaaattgagcagcattttaaagcg
atcatggagacattgggtctcgacctgaccgacgacagcctgaaagggaccccccaccgg
gtggctaaaatgtacgtgaaagagattttcagcggcctgaatcctaagaataaacccaaa
gccactttatttgaaaataaatacaactacaacgaaatgttggtggagaaagacatcagt
ttttactccaactgtgaacatcactttgtgcctattttcggtaaagcacacgtggcttat
atctcaagcggcaaggtaatcggcctttcgaagctgaaccgcattgtgcagtattttgcc
aaacgccctcaggttcaggagcgtttgacgatacagatcggcaaagaattacaacagatc
ctccaaacggaagatgtggccatagtaatggatgccaagcacctgtgcgtagcctcgcgc
ggtgtacaggatgatacaagcaccacgatcacgtctttttacggcggtaagttcaaagaa
gaagcgaccaaaaatgagtttctgaagtatctgtaa

DBGET integrated database retrieval system