KEGG   Runella slithyformis: Runsl_5261
Entry
Runsl_5261        CDS       T01553                                 

Definition
(GenBank) Tetratricopeptide TPR_2 repeat-containing protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: TPR_2 TPR_12 TPR_1 TPR_8 TPR_14 TPR_7 TPR_11 TPR_21 TPR_16 TPR_MalT TPR_6 TPR_19 YfiO
Other DBs
NCBI-ProteinID: AEI51560
Position
complement(6115799..6117313)
AA seq 504 aa
MKKTDVCPCAFFFFLSCFLFYSPSFGQHNPYQLTPTLQQAYAAVFKLKVSSAKALLQQEK
NAGPQKAFAVYAEDYIDMVTLLVSDEKRLFEQLAPNEEARLDYLDDLPADSPYQRLYQAE
IRLHWAFIKLKFGKEVSACWDIIRAYRLLEENAKKYPDFISTYKSLGMLHVLIGSAPQNY
QWVTKLLGLRGNIPQGMREIKTIIQKDPLFGPEARLVELLLQAYILTYAEPQNTALLAFV
NEKEDNLLLHFFGTTISMKDGRGEQALKLLNQRPIGRDYLEFPFLEYLKGEILLQKGQYD
EARTQFKRFLTRYKGQNYLKDTHMKLFLSHWLDGQENLATAYLDRVPAVGTSYVEADKFA
EKFAKSFRKKEVSGQQKALMKARLAFDGGYLPEAALALKPFSESFFTTQYDKAEFHYRWG
RILQRQNQADASITHYERAIALSQPQGLYFGATSALQLGYMYLAKGNRAKAIDHFTQALT
YPKHEYKNSVDNKARAALTLMGVE
NT seq 1515 nt   +upstreamnt  +downstreamnt
gtgaaaaagaccgatgtatgtccgtgcgcttttttctttttcctcagttgcttcctgttt
tattctccttctttcggacaacataatccgtatcaacttacgcccacgcttcaacaggcc
tacgccgcggtcttcaagttgaaagtgtcgtcggcaaaggcgctgttacaacaggaaaaa
aatgcgggcccgcagaaagcctttgccgtgtacgcagaagactatatcgacatggtcacg
ctgttggtgagtgacgagaagcgactgtttgagcaattggcccccaatgaagaggcacgg
ctggactatctggatgatctgccggcagattccccctatcagcgattgtatcaggccgaa
attcggctgcactgggcatttatcaaactgaagttcggcaaagaggtcagcgcctgttgg
gacatcatcagggcgtatcgactcctggaagaaaatgccaaaaaataccctgactttatt
tcgacttacaagtcgttgggaatgcttcatgtattgatcggctcggctccgcaaaattat
cagtgggtcaccaagctcctgggcctgcgcggcaatattccgcagggaatgcgtgagatc
aaaaccattattcaaaaagacccgctctttggaccggaggcgcgcttggtggagttgctg
cttcaggcttatattcttacctatgccgaaccgcagaacacggcgttgctggccttcgtc
aatgagaaagaggataacttactgctccattttttcggcacgacgatttccatgaaagac
ggcaggggagagcaggccctgaaattacttaatcaacgacccatcggtcgtgactatctt
gagtttccgtttttagaatacctgaaaggggagattttacttcaaaaaggtcaatacgac
gaagcacgcacgcagttcaaacgatttttgacccggtacaaaggccaaaattacctgaaa
gacacgcacatgaaactgtttctgagccattggctggacggtcaagaaaaccttgctaca
gcctatctggaccgggtgccggccgtgggcacgagttatgtggaagccgataaatttgcg
gaaaaattcgccaaaagctttcgaaagaaggaagtttcaggacagcagaaagctttaatg
aaagcccggttggcgtttgatggcgggtatttgccggaagccgctttggcattgaaaccg
ttttcggagtcattttttactactcaatacgacaaagctgaatttcactaccgttggggc
cgtattctgcaacgtcaaaaccaagcggatgcttccattactcattatgaacgcgccatt
gcgctcagtcagccgcagggcctgtattttggggccacgtcagccctgcaattggggtat
atgtatctggccaaaggcaacagggccaaggcgattgatcacttcacacaggcgcttacc
tacccgaagcatgaatacaaaaacagcgtggacaataaagcccgcgctgccttgacattg
atgggagtggaatag

DBGET integrated database retrieval system