KEGG   Runella slithyformis: Runsl_5262
Entry
Runsl_5262        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Uma2
Other DBs
NCBI-ProteinID: AEI51561
Position
complement(6117310..6117939)
AA seq 209 aa
MVAVSTKRKRIRTKFAKHEIPKSLIYEEYDGKPMYYRGYKDVLNQRKTTEEIMGESDTQA
IIIGVLMNFLFDTIDRNKYFIVTNEVGFHLKKRSNISSDIVIYEKAALQNHTFKNKYFEI
PPLAVIEVDIQADTADFGISEMDYYGIKTKKLLDFGVREVIWFFSGTQQQFVARAGQDGI
ISTWEKTVSVLDEYQFSLAQLLQKEGFTL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggtagcagtctccaccaaacgcaaacgcattcggaccaaatttgccaaacatgagatc
ccgaaatcgttgatttatgaagaatacgacggaaagcccatgtactatcggggctataaa
gatgtattaaatcaacggaaaacaacggaagagatcatgggcgaaagtgatacccaagcc
attattatcggcgttttaatgaattttttgttcgatactatcgacagaaacaaatatttt
attgtcacaaatgaggtaggttttcaccttaaaaagcgtagtaacatttcctctgacatt
gtcatctatgaaaaggcggccctgcaaaaccatacctttaagaataaatactttgaaatc
cctcccttagcggtcattgaggtggacatacaggctgatacggccgatttcggtatttca
gaaatggattactacggaatcaagaccaaaaaattgttggacttcggcgtgcgggaagta
atttggtttttttcgggaacccaacagcaatttgtcgctcgggccgggcaggacggcatt
atttcgacctgggaaaaaacggtcagtgtgttggatgaatatcaattttcattggctcaa
ctgcttcaaaaagaaggttttacattgtga

DBGET integrated database retrieval system