KEGG   Runella slithyformis: Runsl_5263
Entry
Runsl_5263        CDS       T01553                                 

Definition
(GenBank) transcription elongation factor
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: GreA_GreB PIN_8
Other DBs
NCBI-ProteinID: AEI51562
Position
complement(6117983..6118426)
AA seq 147 aa
MKAAVLERLKAHLDSRMQAALEAMQSAQSSANEETKSSAGDKYETARAMAQNERDRHAQL
YDQIRQERAVLDRIDPLFEFQRVGLGTLVKTTAGYFFVAVSVGLLDMAGTKVIAVSPQSP
LGASLMGKQRGDSFLFQQKKCLIEEIG
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaaagcagccgttttagaacgtttaaaggcacatttggattcccgaatgcaggccgca
ttggaggccatgcaatcggcccaaagttcggccaatgaagaaaccaaaagcagtgcgggc
gataaatacgaaaccgcccgggccatggcccagaatgaacgcgatcgacacgcccaactg
tacgatcagatccgtcaggaacgggccgtgctggaccgcatcgacccgttgtttgagttt
cagcgcgttgggttgggcacgttggtcaaaaccacggcggggtatttcttcgtggccgtc
agcgtaggactgctggatatggcgggaaccaaagtgattgcggtgtcgccgcaatcgccg
ctgggcgcctcgctgatgggaaaacagcgcggcgacagcttcctgtttcagcaaaagaaa
tgtctgatcgaagagatagggtag

DBGET integrated database retrieval system