KEGG   Runella slithyformis: Runsl_5264
Entry
Runsl_5264        CDS       T01553                                 

Definition
(GenBank) Aryl-alcohol dehydrogenase (NADP(+))
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-ProteinID: AEI51563
Position
complement(6118526..6119548)
AA seq 340 aa
MKFKLLGKSGLRVSEICLGTMTFGTEWGWGADKHESKKIFDMYANAGGNFIDTANRYTEG
TSEKFLGDFIASDRDHFVLATKYTLMDRDGDPNYAGNHRKNMIRSLNESLKRLNTDYIDL
FWVHMWDFTTPVEEVMRGLDDLVRSGKVHYIGISDTPAWVISRANMLAELRGWSQFAALQ
IEYSLLQRGAERDLLPMAKALDMAVTPWGVIGGGALTGKYLRGEGGRVPENSLRRNGRSQ
DIAQAVVEIAEELGVTPTQIAINWARQRVSNVMPVIGARRVEQLQDSLKSLDSTIPDEMM
ERLNDLSKIELGFPHDFLSSEGVKQSAFAGMYDQIINHRL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgaaattcaaattattgggaaaatcaggccttcgtgtttcagaaatttgtcttggcacc
atgaccttcgggacggaatggggatggggggctgataaacatgaaagtaagaaaattttt
gacatgtatgccaatgccggcggtaattttattgatactgccaatcgctatactgaagga
acctccgagaaatttttaggggactttatcgcctctgaccgcgaccattttgtactggcc
accaaatatacactgatggaccgcgacggcgaccccaattatgcgggcaatcatcgcaaa
aacatgattcgttccttaaatgaaagcttaaaacgcctcaatacggattatattgacctg
ttttgggtccacatgtgggattttaccacgcccgtagaagaggtcatgcgtgggttggat
gatctggtacgcagcgggaaagtccactacatcggtatttcggatacacctgcctgggtg
atctcgcgggccaatatgctggccgaactgcggggctggagccaatttgccgccttgcag
attgagtattcactgctgcaacgcggggctgaacgcgacctgttgcccatggccaaagcc
ctcgacatggccgttacaccctggggagtgatcggcggcggggccctgacgggcaagtac
ctgcgcggagaaggcgggcgcgtacccgaaaacagcctccggcgcaacggccgcagtcag
gacatcgctcaggcggtggtggagattgcggaggagttgggcgtcacgcccacgcagata
gccatcaattgggcgcggcagcgcgtttccaacgtcatgcccgtcatcggtgcgcggcgc
gtagagcagttgcaggattcactgaaaagccttgattcgaccattccggatgaaatgatg
gagcgattgaatgacctcagcaaaatagaattgggcttcccacacgattttctttcgtcg
gaaggcgtaaaacagtcggcctttgcggggatgtacgaccaaatcattaatcaccgattg
taa

DBGET integrated database retrieval system