KEGG   Runella slithyformis: Runsl_5265
Entry
Runsl_5265        CDS       T01553                                 

Definition
(GenBank) protein of unknown function DUF159
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: SRAP
Other DBs
NCBI-ProteinID: AEI51564
Position
6119690..6120436
AA seq 248 aa
MCFHNSLTATVAEVEQRFEATNKTKQADFEPVYHGNGFDFPVWPVITAQAPKSIQLFQWG
LVPRWVKTKEEAEEMRANTLNAKAETLGEKPSFKYALREAQRCLIPSTGFFEWQTVGKNK
YPYYIRLRNQPIFAMAGLWESWHNPAYPDDIWNTFSIITTEANPLMARIHNTKQRMPLLL
LPGSESLWLQKDLDTAALNEIARPLDDSLMEAFTVGRLVSHRTANSNVPEVTNPYAYPEL
SQQQLSLF
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtgtttccacaattcgttaacagccaccgttgccgaagtagagcaacggtttgaagcc
accaataagaccaagcaggctgattttgagcctgtttaccacggcaacggctttgatttt
ccggtctggcccgtgattaccgcgcaggcccccaaaagtatccaattatttcaatggggt
ttggtgccgcgttgggtcaaaaccaaggaagaagccgaagaaatgcgagccaataccctc
aacgccaaggcagaaacgcttggagaaaagccgtctttcaagtacgctcttcgggaagca
cagcgttgtctgattccgtccacaggcttctttgaatggcaaaccgtggggaaaaataaa
tacccttactacattcgactgcgcaaccaacccatctttgccatggcgggcctgtgggaa
agttggcacaatcccgcttaccccgatgatatttggaatacgttcagcatcatcacgacc
gaagccaatccgctgatggcccgcattcacaacaccaaacagcgcatgcctttgctcctg
ctccccggcagcgaatccctttggctgcaaaaagacctggatactgcggcattgaatgaa
atcgcccgtccgctggatgacagcctgatggaagcctttacggtgggacgtcttgtcagt
caccgtaccgccaactcaaacgtacccgaagtgaccaatccgtatgcctatcccgaatta
tcccaacaacaattgtctcttttttag

DBGET integrated database retrieval system