KEGG   Runella slithyformis: Runsl_5266
Entry
Runsl_5266        CDS       T01553                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Abhydrolase_6 Peptidase_S9 Abhydrolase_3 Esterase
Other DBs
NCBI-ProteinID: AEI51565
Position
6120506..6121417
AA seq 303 aa
MLRKLILWACICGLCGGLSSCFRSWRKNDRDIREHYANRTVKPTFYTIQNDSLKLFVATT
GADTLPPLLLIHGAPGAWYGYLNMVDDSILQRKYHIISVDRLGYNHSIHRKKRIVTSIDL
QARAAALALSLNHSRQKGVLLGRSYGAPIAAKIAILNPTRFHKLVMLAPAIDPAKEKFWW
FSKPAKWWIVRLWLPHRINMASFEKFAHAKELEKLSAEWPLLQVPTTVVQGGKDWIVDPS
NLDYARLKLAEKEAQFIFLPEAGHLITHSHPDLVRELVLTPFQRKALAPAANAAQGGSHE
EHK
NT seq 912 nt   +upstreamnt  +downstreamnt
atgctgcgaaaactcatcctttgggcctgtatctgcggattgtgcggagggctttcatcc
tgttttcgttcgtggcgtaaaaatgaccgcgacattcgggagcactatgccaaccgaacg
gtgaagcctacattttataccatccaaaacgacagtctgaagctgtttgtcgccacgacc
ggtgccgatacgctgcccccgttattgcttatccacggggcgcccggggcctggtacggg
tatctcaacatggtggatgacagcattttgcagcgtaaataccacattatttccgttgat
agacttgggtacaatcattccattcatcgaaaaaaacgcattgtaacctccattgattta
caggcgcgggcagcggctttggcgctgtcgctcaatcattcccgacaaaaaggcgtcttg
ctcggccgctcgtacggtgctcccattgcggccaagatcgccattttgaatccgacccgt
tttcataaactggtcatgctggcccctgccattgaccccgccaaggaaaagttctggtgg
ttttccaaacccgccaaatggtggatcgttcggttgtggttgccgcatcgtatcaatatg
gcttcgtttgagaagtttgcccatgccaaagaactggaaaaactgtcggcggaatggccg
cttctgcaagtgccgaccacggtagtgcagggaggaaaagactggatcgtagacccttcc
aaccttgattatgcacgcttaaaactggccgaaaaggaagcgcagtttatttttttaccg
gaagcgggtcatttaatcacgcattctcaccccgatttggtgcgcgagctggtgcttacg
ccttttcagcgcaaagcgcttgccccggcagcgaacgccgcacagggcgggagtcatgaa
gaacacaaataa

DBGET integrated database retrieval system