KEGG   Runella slithyformis: Runsl_5267
Entry
Runsl_5267        CDS       T01553                                 

Definition
(GenBank) Uncharacterized conserved protein UCP016719
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DUF1343
Other DBs
NCBI-ProteinID: AEI51566
Position
6121585..6122808
AA seq 407 aa
MKRSLYLSLFVASLFLAACAAFTPALQSANAAKGIITGADQTSVYLPYLKGKRIGMLVNQ
TSVIGKKHCVDSLVRLGVRITKIFGPEHGFRGNASNGAKVDDSIDPATGIPVISLYGKNR
KPSKEHLADVDLMIFDVQDVGARFYTYINTLSYVMEACAENDKELLILDRPNPNGFLVDG
PILEPHLKSGIGIFPIPIAHGMTIGEFAQMINGEGWLPNGLKCKLKIIKVANYTHDMPYE
LPVPPSPNLNTQQSILLYPSICLFEGTILSQGRGTYMPFTVLGAPLLKGKYAFSFKPVSL
KGMSETPLHQDTDCYGLDLRKYDTSVFLKTRKLNLQWLMELYAAYPVKEKFFDMSQSKQM
GNFDKLAGTENLKQQIIAGKTEAEIRKSWEPGLSDYKSTRKKYLLYP
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgaaacggtcattgtatctgtctctttttgttgcctccttatttttggctgcctgcgcc
gcctttacccccgccctccaatctgcaaatgccgccaagggcatcattacgggtgccgac
caaacttccgtataccttccctacctgaaaggaaaacgcatcgggatgctggtcaatcaa
acgtccgtcatcggtaaaaagcactgtgtcgacagcctcgtcagactgggcgtccggatc
acaaagatattcgggccggagcacggtttccgcggaaatgccagcaatggagccaaagta
gacgacagcattgaccccgccacgggcattcctgtgatttcactttacggcaaaaaccgc
aaaccctccaaagaacacctggccgatgtcgatctgatgatctttgacgtacaggacgtg
ggcgcgcgtttctatacctacatcaatacgctctcgtacgtcatggaggcctgcgccgaa
aacgacaaagagttgcttattttggaccgccccaaccccaacggttttctcgtagacgga
ccgattttggagcctcatttgaaatcaggcatcggcatctttcccatccccattgcgcac
ggcatgaccatcggcgaatttgcccaaatgatcaacggtgaaggctggttgcccaacggg
ttaaagtgcaaattaaagatcatcaaggtggccaattatacgcacgatatgccgtacgaa
ctccccgtaccgccttctcccaacttaaatacgcagcaatccattctgctgtaccccagc
atttgtctgtttgaaggcactattctgagtcaggggcgaggcacgtacatgccttttacg
gtgttgggtgcccctctgctgaaaggcaaatatgccttttcatttaagccggtaagcctg
aaaggcatgagcgaaacacctttgcatcaggatacggattgttatggattggatctgcga
aaatatgacacctccgttttcctcaaaaccaggaaactaaacctgcaatggctcatggaa
ctgtacgcggcctatcccgtcaaagaaaagttttttgacatgagtcaaagcaaacaaatg
ggaaattttgacaagttggccggaaccgagaacttaaaacaacagatcattgccggaaag
accgaagcggaaatacgtaagagttgggaaccgggtctgagcgactacaaaagcacgcgg
aagaagtatttgctgtatccgtaa

DBGET integrated database retrieval system