KEGG   Runella slithyformis: Runsl_5268
Entry
Runsl_5268        CDS       T01553                                 

Definition
(GenBank) transcriptional regulator, DeoR family
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DeoRC HTH_DeoR HTH_11 GntR E3_UFM1_ligase
Other DBs
NCBI-ProteinID: AEI51567
Position
6122989..6123765
AA seq 258 aa
MIGEQIAYPMIKEERQRLIIEKLNRDQKINLVELSQLLNVSYDSIRRDVIELEDKGLLKK
VHGGAVANSYLSFKTTQGFGIDNQEVLHLTRKAQKLFENHQVVLMDGGTTNFHIAEQFPK
NLELTVITNSLPLAVVLNEHPKIETILLGGTYHKRYQITVGNEAMRQLEHLRVDLYLMGF
NGLDPTVGVTLRNYEESVLKQKMAKSAKKTAICAITEKIHTIETYKVCDLHEIDILVTAV
KPSDPMLNDFRINGLEII
NT seq 777 nt   +upstreamnt  +downstreamnt
atgattggagaacaaatagcttaccctatgataaaagaagaacgccaacgactcattatt
gagaagcttaaccgtgaccaaaaaatcaacttagtggagttaagccaattgctgaatgtc
tcttacgacagcatccgacgcgacgttattgaattggaagacaaaggcttactaaagaaa
gtacacggcggagcggtggccaactcctacctgtcgtttaaaacgacgcagggcttcggc
atcgacaatcaggaagtgctccacctgacccgaaaagcccaaaaactcttcgaaaatcat
caggtggtgttgatggacggcggcacgaccaacttccacattgcggagcagtttcccaag
aaccttgagttgaccgtcattaccaacagcctgccgctcgccgtcgtgctcaatgagcat
ccgaagatcgaaactattctgttgggaggcacctatcacaagcgctaccagatcacggta
ggcaatgaggccatgcgtcaactggaacacctccgcgtagacttatatctcatgggattc
aacgggttagaccctaccgtgggcgttacgctgcgcaattatgaagaatcggttttaaaa
caaaaaatggcaaaatcagcgaagaaaacagccatctgcgccattaccgaaaagatacac
accatcgaaacctacaaggtctgcgatttgcacgaaatagacattttggttactgcggta
aagccttccgaccccatgctgaacgattttcgcatcaacggactggaaatcatctaa

DBGET integrated database retrieval system