KEGG   Runella slithyformis: Runsl_5269
Entry
Runsl_5269        CDS       T01553                                 

Definition
(GenBank) protein of unknown function DUF21
  KO
K03699  putative hemolysin
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:rsi02042]
    Runsl_5269
Bacterial toxins [BR:rsi02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   Runsl_5269
SSDB
Motif
Pfam: DUF21 CorC_HlyC CBS
Other DBs
NCBI-ProteinID: AEI51568
Position
complement(6123809..6125050)
AA seq 413 aa
MSEIALVSSRKSKLETASRNGDRQAKHALELANSPNRFLSTVQIGITLIGILNGVFSGER
ITTDFQAYVEQYDLLKPYAHSIAVGGVVLFVTYLSLVLGELVPKRIGMSNPEGIAKFMAT
PMNWLSTLTSPFIWLLAQSSDLIMKLLRITPQNQAITEEEIKTIIQEGTTGGVIDEIEQE
IVENVFHLGDRKITSLMTNRQEVTWLDSADEPAENKARIMESKHSIYPLCNDGIDNIVGL
IYVKDLLGGDLDEQLTRLDSLAREPLYIPENNKAYQALEKFKESRVHFGIIVDEYGAMLG
IATLNDILDALVGDLSETDEFNYDIVEREDGSFLVDAQLPWEDFINHFDITVHRKKELTG
FNTLGGFALHIFRDIPDTGEHFTWQDYRFEIVDMDKSRIDKILVQKIGEEKEG
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgtcagaaatcgcgctggtctcctcgcgaaagtctaaattggaaactgcgtcacgaaac
ggtgaccggcaggccaaacatgcacttgaactggcaaattcccccaatcgctttctttct
acggtccaaatcggcatcaccctcatcggaatcctgaacggggtattcagcggtgagcgc
atcacaaccgactttcaggcatacgttgagcagtacgatttgctgaagccttatgcgcat
tccattgccgtaggcggcgtggtattgtttgtgacctacctctctttggtgctcggagaa
ctcgtgcctaagcgcatcggcatgtccaatcccgaaggcatcgccaagtttatggctacg
cctatgaattggctttccacccttacgtccccttttatttggctgttggcccaatccagc
gacctgatcatgaagctcctgcgcattacacctcagaatcaggccatcacggaagaagag
atcaaaaccattattcaggaaggtaccacgggtggagtgatcgacgagatcgagcaggaa
atcgtggagaatgtctttcacctcggcgaccggaagatcacgtcgctgatgaccaaccgt
caggaggtgacgtggctggattcggccgatgaacccgctgaaaacaaagcccggattatg
gagtccaaacattccatctatccgctgtgcaacgacgggattgacaatatcgtcggattg
atttacgtaaaggacctcctcggcggcgatctggacgagcaattgacgcggctggattca
ttggcccgggagccgctttatattcccgaaaacaacaaagcctatcaggcattggagaaa
ttcaaggaaagtcgggtacacttcggcatcatcgtcgacgaatacggggccatgctcggc
attgccacgctcaacgatattttggacgccctggtgggtgatctgtcggagacggatgag
ttcaattacgatattgtggagcgcgaagacggcagttttctggtcgatgctcagcttccg
tgggaagattttatcaatcattttgacattaccgttcaccggaaaaaagaattgacgggc
ttcaatacgctcggcggctttgcgctgcatatcttcagggatatccccgataccggcgag
cactttacgtggcaggactaccgatttgagatcgttgatatggacaaaagccgtatcgac
aagatactcgttcaaaagatcggcgaagaaaaggaaggttaa

DBGET integrated database retrieval system