KEGG   Runella slithyformis: Runsl_5270
Entry
Runsl_5270        CDS       T01553                                 

Definition
(GenBank) NUDIX hydrolase
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: NUDIX DUF5845
Other DBs
NCBI-ProteinID: AEI51569
Position
6125203..6125892
AA seq 229 aa
MIIFIKDRPVRILSEKAAQGLSNRATFDRIIDAHLEMLKVVSLKGHLLILNATPITAEKL
FHFLNNYDLPELQSIYLVPKDREAVEKRLKKIYTVIKAAGGIVTKDNKMLMMFRRGVWDL
PKGKLDDNEKSKKAALREVEEETGVKAELIEKTCTTWHTYTQNNQLILKRTKWYWMRCVD
DSKMAPQHDEGIEQLAWMSEPEARKALVNSFSSIRYVVDCFMGQEVDVD
NT seq 690 nt   +upstreamnt  +downstreamnt
atgatcatatttattaaagaccgaccggtccgaattttaagcgaaaaagcggctcagggg
ctctccaatcgagctacttttgaccgaatcatcgacgcccacctcgaaatgctgaaggtg
gtaagtttaaaggggcacctactcattttgaacgccacgccgattacggccgaaaaattg
tttcattttttaaacaattacgaccttcccgagctgcaatccatttatttggtgcccaaa
gaccgcgaagccgtggaaaaacggttgaaaaagatctacaccgtcattaaagccgccggc
ggtatcgtaaccaaagacaacaagatgctgatgatgtttcggcggggcgtgtgggatcta
cccaagggcaaactcgacgacaatgaaaaatccaaaaaagccgccctccgcgaagtagaa
gaagagacaggcgtcaaagccgaacttatcgaaaaaacctgtacgacctggcatacttat
acccaaaacaaccaactcattctgaaacgcaccaaatggtattggatgcgctgcgtggat
gactccaaaatggctccccagcacgatgaaggcattgagcaattggcgtggatgagcgag
cccgaagcccgcaaagccctcgtcaactccttcagttccatccgctacgtggtggattgc
tttatggggcaggaagtggatgtggattag

DBGET integrated database retrieval system