KEGG   Runella slithyformis: Runsl_5271
Entry
Runsl_5271        CDS       T01553                                 

Definition
(GenBank) Site-specific DNA-methyltransferase (adenine-specific)
  KO
K03427  type I restriction enzyme M protein [EC:2.1.1.72]
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:rsi02048]
    Runsl_5271
Enzymes [BR:rsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     Runsl_5271
Prokaryotic defense system [BR:rsi02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   Runsl_5271
SSDB
Motif
Pfam: N6_Mtase HsdM_N UPF0020 GEMIN8 Pox_LP_H2 Nif11 Vault AviRa
Other DBs
NCBI-ProteinID: AEI51570
Position
6126186..6128243
AA seq 685 aa
MITKQALGSTLFGMADILRDKVEDYKAYILSLLFFKRLSDNYEWETENEIKEFEKRERRQ
PTERELAIIMREKHDFKIPEGCFWKDVRDASPDKKNEKLNHAVNEIADANIDRNGKAILK
GVINTVRWNEPAPDGSGSKKLSPQVLTALVSYLDAVDLSNKNASVDVLGDAYEYLIKRFA
DENKGGTTAGQFYTPQEVVDIIVRYLKPQKGNTVYDPTCGSGGFLINAAKYCKANYNNPK
AIRIFGQEDVWNTWAICNINMILHGLDARIEKGDTILDPKFTDDDNNLAVRQFDLAMANF
PFSQENWTKTGQPKKDSKGKTVNKKDGSPQLEYPKEGYSDPYERLVYGTPPYSNGDFAFL
QHIVASIKDNGKAGVVCPQGVLFRGQPEKTEEEDGQNRKADDEYLIRRGFLQGKIDHNGE
FTEMHNIIDAIVVLPANLFYGTTIPGAILFINKNKPAHRKDKVLMVYAAKEGWYKEEANM
NVLLPHDILRISTILESWGDLETAKTWIDSQKTRLKNLIQEDLDFKLLELEEYYAEDIER
KTEKLAKVQKVIEDKQAKNEKPTKGDWKAVETAQNALDKLTNEKDNKINAAHEQAEKERQ
AIDAVEQELIAMLQDPELRKRYFAIADMEELEENEFNLNIPRYVDTFEPEEEIDLKQAIA
EFKATLRQETALDSTIEELLKVFNG
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgattacaaaacaagcattaggaagtacactttttggaatggccgacattcttcgggat
aaagtggaagattataaagcctacattctttccctactcttttttaagcgactttctgat
aactacgaatgggaaaccgaaaacgaaatcaaagaatttgagaaacgggaacgcagacaa
ccgactgaacgggaattggcaattattatgcgtgaaaaacacgatttcaaaattcccgaa
ggttgcttttggaaagatgtgcgtgatgcctcacccgataagaaaaacgaaaaactcaac
catgctgtcaacgaaatagccgacgccaacatagaccgaaacggcaaagccattctgaaa
ggcgtcatcaataccgtgcgttggaacgaacccgcccccgatggctccggaagtaaaaaa
ctaagtccacaagtgctgaccgccttggtgagctacttagatgccgtggatttgagcaac
aaaaacgcttcggtagatgtcttgggcgatgcgtatgagtacctcatcaaacgctttgcg
gacgaaaacaaaggcggcactaccgcaggacaattctacaccccgcaggaagtggtggat
attattgtacggtatctcaaacctcaaaaaggaaataccgtctatgaccccacttgtggc
tcgggcggcttcctgatcaatgccgccaaatactgcaaagccaactacaacaaccccaaa
gccattcggatttttggacaggaagatgtttggaacacgtgggcgatttgcaatatcaac
atgattttgcacggtttagatgctcgtattgaaaaaggggatactattctcgacccaaaa
tttaccgatgacgataacaatttagctgtaagacaattcgatttggcaatggccaatttc
ccattctcacaagaaaattggaccaaaacagggcaacccaaaaaagacagcaaaggcaaa
accgtcaataaaaaagacggctcgccccaattggagtaccccaaagaaggctactccgac
ccctacgagcggctggtgtatggcacaccgccctattccaacggtgattttgcttttttg
cagcacatcgtcgcctctatcaaagacaatggaaaagcgggcgtagtttgtccgcaaggg
gtgttgtttaggggacagcccgaaaaaaccgaagaagaagacgggcaaaaccgcaaagcc
gatgacgagtacctgatccgcaggggatttttgcagggcaagattgaccacaatggcgag
tttaccgaaatgcacaacatcattgatgctatcgtggtgctgcccgccaatctgttttat
ggcaccaccatacctggggcgattttgtttatcaataaaaacaaacccgcccaccgcaaa
gacaaagtgctgatggtgtatgccgccaaagaaggctggtacaaagaagaagccaatatg
aatgtgctgctaccgcacgacatcctgcggatttcgaccattttggaaagttggggcgat
ttggaaacggccaaaacgtggatagattcccagaaaacaaggctcaaaaatctgatacag
gaagacctcgattttaaactcctggaactcgaagaatactatgccgaagacatcgagcgg
aaaaccgaaaaattggccaaagtccaaaaggtaattgaagacaaacaagccaaaaacgaa
aagcccaccaaaggcgattggaaagcggtggaaaccgcccaaaatgccttggacaaactc
accaacgaaaaagacaacaaaataaacgccgcccacgagcaagccgaaaaagaacgccaa
gccatagatgccgtagagcaggaactcatagccatgctgcaagaccccgagctgcgcaaa
cgctactttgccattgccgatatggaagagctcgaagaaaacgagtttaatctcaatatc
ccccgctacgtagacacctttgaacccgaagaggaaattgacctcaaacaagccattgcc
gagtttaaagccaccctccgccaagaaaccgcactggacagtacgattgaggaacttcta
aaagtatttaatggatga

DBGET integrated database retrieval system