KEGG   Runella slithyformis: Runsl_5272
Entry
Runsl_5272        CDS       T01553                                 

Definition
(GenBank) protein of unknown function DUF1016
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: YhcG_C DUF1016_N HTH_ParB HSDR_N_2
Other DBs
NCBI-ProteinID: AEI51571
Position
6128240..6129316
AA seq 358 aa
MKIEQNTHSQYIADIKAILAAAKQQVYSAVNTAMVQAYWLIGKRIVEQEQHGKERAEYGS
FLIKNLAEELTNEFGKGFSEQSLKNFRQFYVVFNDLPISSTMWNELSTQKGSTLWSQLSW
SHFKALMRVTNPEARAYYLKETAENNWSVRTLDRNIATQYYERLFLSHAKQPVVDEMKEK
NQAFALDKNEFLKSPAVLEFLNIAPNKGYTEAQLEKAIIDNLQEFLLELGKGYAFVARQQ
IIKTQTRDYFIDLVFYNFMLKCFVLIDLKTERISHQDVGQMDMYVRMYDEEKKADNDNPT
IGIILCSETDQDIARYSILKGNEQLFASKYKLYLPTEAELKAEIEREKLNFKLQQNLS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaaaatagagcaaaacacacattctcagtacattgccgacatcaaagccatccttgct
gccgccaaacagcaagtatatagtgccgtaaataccgccatggtgcaagcctattggctc
attggcaagcgaatagtggaacaagaacaacacggtaaagaacgggccgaatacggtagt
tttttgattaaaaaccttgccgaagaattaaccaatgaattcggaaagggtttttcggag
cagagtctcaaaaatttcagacagttttatgtcgtattcaatgaccttccaattagctct
accatgtggaacgaattgtcaactcaaaaaggctctacactgtggagccaattgagttgg
tcacattttaaagccttaatgcgagtaaccaaccccgaagcacgggcctactacctcaaa
gaaaccgccgaaaacaattggtcggtgcggacgctcgaccgaaacatcgccacccaatac
tacgagcggctttttctctcgcacgccaaacagcccgtggtggacgaaatgaaggaaaaa
aaccaagcctttgccttggataaaaatgaatttctgaaaagccccgccgttctggagttt
ctcaacattgcgcccaataaaggctacaccgaagcccaactcgaaaaagccattattgac
aacctacaggagtttttgctcgaactcggcaaaggctacgcttttgtggctcgccagcaa
attatcaaaacccaaaccagagactatttcattgacctcgttttttataattttatgctc
aaatgcttcgtactgattgacctcaaaaccgaacgcatctcgcaccaggacgtaggacaa
atggatatgtacgtgcggatgtatgacgaagaaaaaaaagccgacaacgacaaccccacc
attggcatcattctctgctccgaaaccgaccaagacatagcccgctactccatcctcaaa
ggcaacgaacaactctttgcctctaaatacaaactctacctgcccaccgaagccgaactg
aaagccgaaatagaacgtgaaaaactcaattttaaactacaacagaacttgtcgtaa

DBGET integrated database retrieval system