KEGG   Runella slithyformis: Runsl_5273
Entry
Runsl_5273        CDS       T01553                                 

Definition
(GenBank) restriction modification system DNA specificity domain protein
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:rsi02048]
    Runsl_5273
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     Runsl_5273
Prokaryotic defense system [BR:rsi02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   Runsl_5273
SSDB
Motif
Pfam: Methylase_S
Other DBs
NCBI-ProteinID: AEI51572
Position
6129381..6130694
AA seq 437 aa
MENEIKGWKIKRIKDVLSVNSETLTSNTKPNKVFNYISIESVEQEKIDFSKIIKAEFKEL
PSRARRKLKDGDLLFSTVRPNLKSFSIFKKPNNEDWIASTGFAVANAKGNNDSKFFFYQL
LSPIGEKQFHSLVVGSNYPAINETDFNKLKVFVPENPAEQTAIATILSKVDEAIAATQNS
INAAEKLKKSLMQNLLTGKLKPDGTWRTEDEFYDDEKFGKVPKGWEVKPLKELAGIQRGK
FSHRPRNEERFYNGVHPFVQTSDVVKSVFYLKEHSQTLSDLGVGVSKKFERGTIIITIAA
NIGDVALAKYDVYFPDSLIGIMPNNEIIDSEYLLISLMTKQRLLNQVATESAQKNINYGN
LRPLPIFYPKSIESQQQIASQIKSCFETIESKQTKIQTLQRLKKSLMQQLLTGKVRLPQA
FVEQFESEMAAPQPTEK
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggagaatgaaattaaaggatggaaaattaaacgtataaaagatgttctttcagttaat
tctgaaactctaacttcaaatacaaaacccaataaagtctttaattatatttcgatagaa
agtgtcgaacaagaaaaaatagatttttcaaaaatcattaaggcggagtttaaagaactg
ccaagtcgtgcaagaagaaaattaaaagatggagatttattattttcaactgttagaccg
aatttaaagagtttttcaattttcaagaaacccaacaacgaagattggattgcctcaaca
ggttttgcagtagcaaatgccaaaggaaataatgactcaaagttttttttctatcagtta
cttagccctatcggagaaaaacaatttcatagtcttgtagttggatcaaattatcctgca
ataaacgaaactgatttcaacaaattaaaggtttttgttcccgaaaacccagccgaacaa
accgccatcgccaccattttatccaaagtagatgaagccatagccgccacgcaaaacagc
atcaatgccgccgaaaaactcaaaaaatccctcatgcaaaacctgctcacgggcaaacta
aaacccgatggtacttggcgcaccgaagacgagttttatgacgatgaaaagtttggcaaa
gtgccgaaggggtgggaagtgaaaccattaaaagaattggcaggaatccaacgaggaaaa
ttcagtcacagaccaagaaatgaagaaaggttttacaatggtgtccacccttttgttcag
acaagtgatgtagtaaaaagcgttttttatttaaaagagcattctcaaacccttagcgat
ttgggtgttggtgtaagtaaaaagtttgaaagaggaacaataatcattacgattgctgca
aatattggtgatgtagccttagctaaatatgatgtttactttcctgatagtttgattgga
attatgcctaacaatgagataatagatagtgaatatcttctcatttctttaatgactaaa
caacgattactaaatcaagtcgccactgaaagtgcccaaaagaatattaattatggaaat
ttaagaccattacctattttttatccaaaaagcattgagagtcagcaacaaatcgcttcg
caaataaaatcttgtttcgagacaatagaatctaaacaaaccaaaatccaaacgcttcaa
cgcttaaaaaagtcgttgatgcagcagttgctcacgggtaaggtgcggttgccgcaggcg
tttgttgagcagtttgaaagtgaaatggcagcaccacagccaaccgaaaaatag

DBGET integrated database retrieval system