KEGG   Runella slithyformis: Runsl_5275
Entry
Runsl_5275        CDS       T01553                                 

Definition
(GenBank) protein of unknown function DUF45
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DUF45 WLM DUF2268
Other DBs
NCBI-ProteinID: AEI51574
Position
6133779..6134435
AA seq 218 aa
MELPEHYILIRKEVKHARIRVSEDGRVRIIAPPDFSDEDIALILKKKAKWIDTNLKYFKG
MSSIELQRNQLLLFGTRYHYFYDTTYAQKVIIDHEHKTIISKRDLIKPIIQEDWYRTIAK
KHLTKRTKELSAKLKLPFNKFFIRESKTKWGNCSSDKNISLNWKLIKAPDYVIDYLIVHE
LLHTVVMSHTTKFWTLLKSYYPNYRESIKWLEKYGNSL
NT seq 657 nt   +upstreamnt  +downstreamnt
atggagttacctgagcattatatattgattcgcaaagaagtaaaacacgcccgaatcagg
gtaagtgaagacggacgagtgcgcattattgccccgcccgatttttcggatgaagacatt
gctttgattcttaaaaagaaagccaagtggattgatacaaacttgaagtactttaaaggg
atgtcaagcattgaattacaacgcaatcaactgctgctatttggcacacggtaccattat
ttttatgatacgacctacgctcaaaaggtcattattgaccacgaacacaaaacgattata
tcaaagcgagatttgataaagcctatcattcaggaagattggtatagaactattgccaaa
aaacacctgaccaaacgaaccaaagaattgtcggcaaaactgaaactgccgttcaataag
tttttcatacgggaatcaaaaaccaagtggggcaattgttcaagtgataaaaacatttca
ttgaattggaaactcataaaagcccctgactatgtaatagattacttaatagtccacgaa
ctcttacacacagtcgtcatgagccacaccaccaaattttggactttattgaaatcatac
tacccgaattacagagaatccatcaaatggttagagaagtatggaaatagcttataa

DBGET integrated database retrieval system