KEGG   Runella slithyformis: Runsl_5276
Entry
Runsl_5276        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Other DBs
NCBI-ProteinID: AEI51575
Position
6134656..6135405
AA seq 249 aa
MHRKLAPLCSVILFVVLSGVQTGALAQGPGPGQRIPLPPIPIKGDTTHTLSKHFTLATTA
AKTTDAKGFIQRWLVLEPVKKDIVRNNIFTDNYLRTAFSTDNFSNDYTTVPKNGETVKVG
DRELKWYALDSKTFNVNLYHFTYALNKPRYGILVWLVTVIDCPEEIQNVRLAAGCNSGSM
WWLNGREALLLSGDRDMIADNGTSARLTLKKGRNILRGAVINGPGMANFCVRFLDEKGTP
VTNLSLRYE
NT seq 750 nt   +upstreamnt  +downstreamnt
atgcaccgcaaactcgcccccttgtgttcggttatcctttttgtcgttttatcaggagta
caaacaggtgctttggcgcagggccccggtccggggcaacgaataccgctcccgcccatt
ccaatcaaaggcgatacgacccataccctatccaaacacttcacgctcgccactaccgcc
gcaaaaacaacggatgccaaggggtttattcaacgttggctggtgctggaaccggtaaaa
aaagacattgtcagaaataatattttcaccgacaactacctccgaaccgccttttccacc
gataatttttccaacgattacaccaccgttcctaaaaacggcgaaacggtaaaagtaggt
gaccgcgaactgaagtggtatgccttggacagcaaaactttcaacgttaatttataccat
tttacctacgccctcaacaaacccagatacgggatactggtatggctcgtcacggtcatc
gactgccccgaagaaatccaaaacgtcaggctggcggcgggctgtaattccggaagcatg
tggtggctgaacggccgggaagccttactgctttccggtgaccgggatatgatcgccgat
aacggtacctcggcacggttgacgctcaaaaagggaagaaacatccttcgcggggcggtc
atcaacggcccgggcatggccaatttctgcgttcgttttttagacgaaaagggaaccccc
gttaccaacctaagcctccgttacgaataa

DBGET integrated database retrieval system