KEGG   Runella slithyformis: Runsl_5277
Entry
Runsl_5277        CDS       T01553                                 

Definition
(GenBank) glycoside hydrolase family 43
  KO
K06113  arabinan endo-1,5-alpha-L-arabinosidase [EC:3.2.1.99]
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Runsl_5277
Enzymes [BR:rsi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.99  arabinan endo-1,5-alpha-L-arabinanase
     Runsl_5277
SSDB
Motif
Pfam: Glyco_hydro_43 RicinB_lectin_2
Other DBs
NCBI-ProteinID: AEI51576
Position
6135477..6136886
AA seq 469 aa
MLVALWINLTVQAQVGRPFIHDPSTVTECDGKYYTFGTGGGGLISNDGWTWHGGGVRPGG
GAAPDVIKIGDRYLVIYGATGGSPNHKGAILTMWNKTLDPKSPDFKYSEPIVVATSDGYE
ENDAIDPGVMMDPTTGRLWLTYGTYFGYTRLIELDPKTGKLKAGNKPVDVAIVCEASTLV
YRDGWYYLLATHGSCCDGANSTYNVVVGRSKKITGPYLDNVGRSMLEGGGKMVVATRGGL
IGPGHFGHIVLEPGVEKMSLHYEADLAQGGRSVLGILPVVWKDGWPVAGEKFKEGTYEIE
SVRRGYALELAVDFTRMPVVRGFGQPINEPIKPVPAQQLADVQKTWPTGPINLRIGDYMS
RPHQQWTITDAPDTTGYLGGPYYKIVLAGTDRALAATADAEVITVPAFTGAPEQLWRIDQ
LTDGTYRISPKTVPNSGKKLALVSSGDSTPTLAEFDFTGDNSKWNFRAP
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgttagtggccttatggatcaaccttaccgtacaggcacaggtcggaagaccctttatt
catgacccctccaccgtcaccgaatgcgacggcaagtattataccttcggcaccggcggc
ggcggattgatttccaacgacggctggacatggcacggcggcggggtacgacccggtggc
ggagccgccccggacgtcatcaaaatcggggatcgttacctggtcatctacggagccacc
ggcggctcacccaaccacaaaggcgctattttaaccatgtggaacaagacattggacccc
aagtcgcctgattttaagtactctgaaccgattgtcgtggctacgtcggatggctacgaa
gaaaacgacgccatcgaccccggggtgatgatggaccctacgaccggacgcctttggctc
acctacggcacctatttcggctacacccgcctgatcgaattggaccccaaaacgggaaaa
ctcaaggcagggaataaacccgtagatgtagccatcgtatgcgaagccagcacgttggtc
taccgcgacggctggtactacctgctggccacgcatggcagttgctgcgacggggccaac
tctacctacaatgtggtggtaggtcggtctaaaaaaataaccgggccttaccttgataac
gtaggccgaagcatgctggaaggcggcgggaagatggtggtggctacccgcggcggattg
atcggcccgggacattttggacacatcgttttggaaccgggagtggaaaaaatgtccctc
cattacgaagccgatctggcgcagggcgggcgaagcgtgttgggtatccttccggtggtt
tggaaagacggatggcccgtagccggcgaaaagtttaaagaaggtacgtatgaaattgaa
tccgtacgccgaggctatgccttagagttggccgttgattttacccgaatgcccgtagta
cggggattcggtcagccaatcaatgaaccgataaaacccgttccggcacagcaattggcc
gatgtacagaaaacctggcccaccggtcccattaacctgcgaataggcgactacatgtcg
cgcccgcatcagcaatggaccattaccgatgcgcccgatacgaccgggtatttgggcgga
ccgtactataaaattgtattggccggcaccgatcgggccttggcggccacggccgatgcc
gaagtcatcaccgtaccggcatttaccggcgcgcccgaacagctatggcgcatcgaccaa
ctgacggatggcacctaccgaatctcgccgaagacagttcccaattcaggcaaaaagtta
gcgttggtctcttccggcgacagcacccccaccctggcagaatttgattttaccggcgat
aactccaaatggaatttcagggctccctaa

DBGET integrated database retrieval system