KEGG   Runella slithyformis: Runsl_5278
Entry
Runsl_5278        CDS       T01553                                 

Definition
(GenBank) regulatory protein MarR
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: HTH_27 MarR
Other DBs
NCBI-ProteinID: AEI51577
Position
complement(6137025..6137681)
AA seq 218 aa
MEKLVELVNLWAEYSRENPDLEIKDFCTNYLTDHCESVLRKEPLGEEESARPLNQESDID
GELAALVGRLTRFAYFYSKKAIEKLPVANVDDILYLHLMMVMNAPKKSELIVALLSEFAS
GIDIINRLLKAGLCEEFPDENDKRAKRVKITPAGVYVLHHSSPVMAQIAQIAFNELTLIE
KVMITTILKRADRFHSKHYGDFKGQTFDEIYKKVMTIG
NT seq 657 nt   +upstreamnt  +downstreamnt
atggaaaaactggttgaattagtcaatctttgggccgaatacagtcgtgaaaatcctgat
ttagagatcaaagatttttgtaccaactacctgaccgatcactgcgaaagtgttttacgg
aaagagccgttaggagaggaagaatcagcaagaccgttgaatcaggagagcgacattgac
ggtgagttggcggccttggtcgggcggctcacgcgcttcgcctatttttattccaaaaaa
gccattgaaaaacttcccgttgccaatgtagacgatattttgtatctgcacctgatgatg
gtcatgaatgctcctaaaaagagtgaattgatcgttgcattgttgtcagaatttgcgtcg
ggtattgacatcatcaatcgattattaaaagcagggttgtgcgaagaatttcccgacgaa
aatgataaacgggccaaacgggtcaaaatcactcctgcgggggtgtatgttctgcaccat
tcttcgccggtcatggctcaaatcgcccaaatcgcgttcaatgaattgacgcttattgaa
aaagtgatgattaccactattctgaaaagggcggacaggtttcactccaaacactacgga
gattttaaagggcagacgtttgatgaaatttataaaaaagtaatgacgatcggataa

DBGET integrated database retrieval system