KEGG   Runella slithyformis: Runsl_5279
Entry
Runsl_5279        CDS       T01553                                 

Definition
(GenBank) Phosphonate-transporting ATPase
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsi02000]
    Runsl_5279
Transporters [BR:rsi02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    Runsl_5279
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 AAA_23 AAA_25 AAA_13 AAA_16 AAA_22 AAA_18 ABC_ATPase AAA_28 AAA_30 Rad17 RsgA_GTPase AAA_33 AAA_24 NACHT cobW
Other DBs
NCBI-ProteinID: AEI51578
Position
6137812..6138498
AA seq 228 aa
MIAELIGAGKEYKTGDQTIVALQPTTWQVNEGELTLIIGPSGSGKTTLLSLLGCVIYPSY
GDLWVDGRHINELNENQLARLRLETIGFVFQGFNLLAPLSAEDNVELPLKLLGVGSKERR
QRVKKALEIVGMTDRRKNLPKALSGGQQQRIAIARALVTEPKLILCDEPTASLDKDSLVV
VMQELKILAQKGKAVVVVTHDPRLRQYADRAIEVKNGMVTPIELNDVQ
NT seq 687 nt   +upstreamnt  +downstreamnt
atgattgcggaactaattggggcaggtaaggaatacaaaacgggcgaccaaaccattgta
gccctgcaacctactacgtggcaggtgaacgaaggagagctgaccctcatcatcggcccg
tccggctcaggcaaaacaacgctgctttcgctgttaggctgtgtgatttatcccagttat
ggcgatttgtgggtcgatggacggcacattaatgaactgaatgaaaaccaattggcccgc
ttacgcttggaaaccatcggcttcgtctttcagggctttaacttactggctccgctcagt
gcggaagacaatgtcgaattaccccttaaactcttaggagtgggaagcaaggaacgccgg
caacgcgtaaaaaaagcactcgaaatcgtaggcatgaccgaccgccgcaaaaatctgcct
aaagcgctgtcgggagggcaacaacagcgcattgcgattgcccgggcgttggtgaccgaa
cccaaacttattttgtgcgatgagcctaccgcctctctcgacaaagattcgctggtggtg
gtgatgcaggaacttaagatcttggcccaaaaagggaaagcggtggtcgttgtaactcac
gacccgcgcctgcgccaatatgccgaccgggccatagaagtaaaaaacggaatggttact
cccattgaattaaatgatgtacaataa

DBGET integrated database retrieval system