KEGG   Runella slithyformis: Runsl_5281
Entry
Runsl_5281        CDS       T01553                                 

Definition
(GenBank) protein of unknown function DUF214
  KO
K02004  putative ABC transport system permease protein
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsi02000]
    Runsl_5281
Transporters [BR:rsi02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    Runsl_5281
SSDB
Motif
Pfam: FtsX
Other DBs
NCBI-ProteinID: AEI51580
Position
6139486..6140604
AA seq 372 aa
MFKEAFKFMWYDRAKMFGILFGMILSVFLVGQQVMICLALLGGTVSLATFNKEYIWVVSD
KSKQVTDLPLIDMRIARELRTVNGVKAVHPMILSAGTLKFNDGLTFPVSLVGTQAPVFAG
GPWRVAVGKPMDMLQDEGVFLDAQNSEFGKFLKRGDRHEFNGKRIKIAGLTAKTEGLGNT
YGFTTIERARYLCNIPTTRASAFLVESQRGFFPDTVVANIEHELPGIKARTGEAFEQESL
RYFAGSSGIVASFGLLVVFAVITGFAIVGLTMYSAVSDRLRDYGTLKAIGGTNATIRRLI
LSQAAIYALVGFGLAYGLLLFFINATKGSLDLQLTPLLSYSLVGVTLFIALLGSWFGMRR
ILKLEPAQVFRT
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtttaaagaagcattcaaatttatgtggtacgaccgggccaagatgttcggtatcctg
ttcggaatgattctgtccgttttcttggtcggtcagcaggtgatgatctgtctggcgctg
ctgggggggacggtttcactggcgaccttcaataaagaatatatttgggtcgtgagcgat
aaaagtaagcaggtcaccgacttacctttgatcgacatgcgcatcgcgcgcgagctgcgt
accgtcaacggcgtcaaagccgtccaccccatgattttgtcggccgggacccttaagttt
aacgacggcctgacgttccccgtttcgctggtgggcacgcaggcccccgtatttgccggc
ggcccttggagggtagccgtgggaaaacccatggatatgctgcaggatgaaggcgtattt
ttagacgcgcaaaactccgagttcgggaaatttcttaaacggggcgaccggcatgagttt
aacggaaaacgcatcaagatcgcgggccttacggccaaaaccgaaggcttgggcaatacc
tacggttttaccaccatcgagcgggcccgttatctgtgcaacattcccaccacccgggca
tcggcttttttggtggagtctcaacggggattttttcccgacaccgtcgttgccaacatt
gaacatgaacttccgggcattaaagcccgtaccggcgaggcgtttgagcaggagtcgctt
cggtattttgccgggagcagtgggatcgtcgcttccttcggtctattggtcgtctttgcc
gtgatcacgggctttgccattgtgggcctgacgatgtattccgccgtcagcgaccgactg
cgcgactacggtaccctcaaagccatcggcggcaccaacgccaccatccgacggttgatc
ctgtcgcaggcggcgatctacgccttggtgggttttgggttagcctatggattgctgctc
ttttttatcaacgccaccaaagggtccctcgacctgcaactgaccccgctcctgtcttat
tcgttggtgggcgtcacgcttttcattgcgttgctgggaagctggtttgggatgcgccga
atcctgaagttggaacctgctcaggtatttcgtacctaa

DBGET integrated database retrieval system