KEGG   Runella slithyformis: Runsl_5285
Entry
Runsl_5285        CDS       T01553                                 

Definition
(GenBank) transposase IS116/IS110/IS902 family protein
  KO
K07486  transposase
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    Runsl_5285
SSDB
Motif
Pfam: Transposase_20 DEDD_Tnp_IS110 Allexi_40kDa 5_3_exonuc HHH
Other DBs
NCBI-ProteinID: AEI51582
Position
complement(6144251..6145210)
AA seq 319 aa
METQYFIGIDISKESLNWAVCSSNKIILEHVSGNDIKSITKTVISLQRQLNFKLGSAVFC
MEHTGIYHTRLLKYLLSRKAAIWLESGSQIKYSMGDVRGKNDIIDAQRIARYAYKNRDEI
KLYVPPRAIIDQLDNLLDIRDRLVKVRQICLTALNEQKSCEANKTLTKDTKKYSAHTLKG
VETDLQTLEKQIKELIDSDPQLKSLFDNITSIPGVGTVTAAKCIVITDEFKKFENAKQLA
CHAGVVPFENSSGSSLHSKPKVSKKAHKGIKATLSNCVMSAMRYNTHFKAYYERKLKEGK
NKFTVFNAMKNKLVRLIFL
NT seq 960 nt   +upstreamnt  +downstreamnt
atggaaacacagtattttatcggtattgacatctccaaagaaagtttgaattgggcagtt
tgtagttctaataagattatcttagaacatgtttcgggtaatgatataaagagcataacc
aaaactgtaataagcctacaaaggcagttaaattttaaacttggaagtgccgttttttgc
atggaacacaccgggatttatcacactcgtttattgaaatatctgctgagtcgcaaagct
gcaatttggttggaatcaggtagccaaataaagtactcaatgggcgatgtcagaggcaag
aatgacatcattgatgcccagcgtattgctcgttatgcttataaaaatcgcgatgaaatc
aagctttatgtgcctcccagggctataattgatcaattggacaatctgcttgacattcgt
gacaggttagtaaaagtacgccaaatttgtctgactgccttgaatgagcagaagtcttgt
gaagctaataaaaccctcacaaaagacacaaaaaaatactctgctcatacgctcaaagga
gtcgaaactgatttgcaaaccctcgaaaagcagattaaagaactcattgattctgatcct
cagctcaaatcactctttgacaacatcacctctattcccggagttggtactgttactgcg
gctaaatgtattgtcataacagacgaatttaaaaagttcgagaatgccaaacaactggct
tgccatgccggggttgtaccttttgaaaatagctctggcagcagtttacactcaaagccc
aaagtcagcaaaaaagctcacaaaggaataaaagccaccttatctaattgtgtcatgtca
gccatgagatataacactcattttaaggcttactatgaacgaaaactcaaagaaggcaaa
aacaagttcaccgtttttaatgccatgaagaacaagctggtcaggcttatttttctttag

DBGET integrated database retrieval system