KEGG   Runella slithyformis: Runsl_5286
Entry
Runsl_5286        CDS       T01553                                 

Definition
(GenBank) hypothetical protein
Organism
rsi  Runella slithyformis
SSDB
Motif
Pfam: DDE_Tnp_1
Other DBs
NCBI-ProteinID: AEI51583
Position
6145486..6146130
AA seq 214 aa
MEHGGFFETFFDVSLYRSQLLIKFGLSTYQRGRIVGIAHQKRWFSVDGKELRGSIQAGQT
RGEVCVSALAHQNQQVVAQTFYNGSKESDRPAVSHLLEHASLWGQKVTLDALHLRPLTLQ
SIHTANGVYVVGLKANQAHLYRYCICRSLFNNPDYEQVDITTKRHSTAVWAFIPAFYKVK
SICDFASLRGALTALMSLFRFHHLTQQRRTDDDC
NT seq 645 nt   +upstreamnt  +downstreamnt
atggaacacgggggcttctttgagacgttctttgatgtgagtctctatcggagtcagttg
ctcataaagtttggtttgagcacttatcagcgtggccggattgtaggcatagcccatcaa
aaacgctggttttctgtggatggaaaagagctgaggggcagtattcaagccggacagaca
cgcggtgaagtatgtgtgtcggcacttgctcatcagaatcagcaggtggtcgcacagact
ttctacaatggttcaaaagaaagtgaccgaccggcagtgagccacttgttggagcatgcg
agtttatgggggcaaaaagtcacgctcgacgctttacatttacgcccattaacattgcaa
tcaattcataccgcaaatggggtttatgtggtgggactcaaagccaatcaggcccattta
taccgatactgcatttgtcggagcttattcaacaatcctgactacgagcaagtggacata
acaactaagcgccactcaacagccgtttgggcgtttatccctgctttttataaagtaaaa
agcatctgtgacttcgcttcgctgcggggagctttgacggccttaatgagcttatttcgc
ttccatcatctcacacaacaaaggagaacggatgatgactgctga

DBGET integrated database retrieval system